KEGG   Macaca mulatta (rhesus monkey): 613249Help
Entry
613249            CDS       T01028                                 

Gene name
UGT2B9*2
Definition
UDP Glucuronosyltransferase 2 family, polypeptide B9*2
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    613249 (UGT2B9*2)
   00053 Ascorbate and aldarate metabolism
    613249 (UGT2B9*2)
   00500 Starch and sucrose metabolism
    613249 (UGT2B9*2)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    613249 (UGT2B9*2)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    613249 (UGT2B9*2)
   00860 Porphyrin and chlorophyll metabolism
    613249 (UGT2B9*2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    613249 (UGT2B9*2)
   00982 Drug metabolism - cytochrome P450
    613249 (UGT2B9*2)
   00983 Drug metabolism - other enzymes
    613249 (UGT2B9*2)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    613249 (UGT2B9*2)
Enzymes [BR:mcc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     613249 (UGT2B9*2)
Glycosyltransferases [BR:mcc01003]
 Others
  Hydrophobic molecule
   613249 (UGT2B9*2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 529 aa AA seqDB search
MSVKWTSVILLIQLSFYFSSGSCGKVLVWAAEYSHWMNMKTILEELVQRGHEVTVLASSA
SILFDPNNSSALKIEVFPTSLTKTEFENISMQEVKRWIELPKDTFWLYFSQMQEIMWRFG
DIIRNFCKDVVSNKKLMKKLQESRFDVVFADPIFPCSELLAELFNIPLVYSLRFTPGYIF
EKHCGGFLFPPSYVPVVMSELSDQMTFMERVKNMIYMLSFDFYFQMYDMKKWDQFYSEVL
GRPTTLSETMGKADIWLIRNSWNFQFPHPLLPNVDFVGGLHCKPAKPLPKEMEEFVQSSG
ENGIVVFSLGSMVTNMEEERANVIASALAQIPQKVLWRFDGKKPDTLGLNTRLYKWIPQN
DLLGHPKTRAFITHGGANGIYEAIYHGVPMVGIPLFADQPDNIAHMKTKGAAVRLDFDTM
SSTDLANALKTVINDPLYKENVMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRPAA
HDLTWFQYHSLDVIGFLLACVATVILVIMKCCLLCFWKFARKGKKGKSD
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgaaatggacttcagtaattctgctaatacaactgagcttttactttagctct
gggagttgtggaaaggtgctggtgtgggcagcagaatatagccattggatgaatatgaag
acaatcctggaagagcttgtccagagaggtcatgaggtgactgtcctggcatcttcagct
tccattctttttgatcccaacaactcatccgctcttaaaattgaagtctttcctacatct
ttaactaaaactgagtttgagaatatctccatgcaagaggttaagagatggatagaactt
ccaaaagatacattttggttatatttttcacaaatgcaagaaatcatgtggaggtttggt
gacataattagaaatttctgtaaagatgtagtttcaaataagaaattaatgaagaaatta
caagagtcaagatttgacgtcgtttttgcagatcctatttttccctgtagtgagctgctg
gctgagctatttaacataccccttgtgtacagtctccgcttcactcctggctacattttt
gaaaagcattgtggaggttttcttttccctccctcctacgtacctgttgttatgtcagaa
ttaagtgatcaaatgactttcatggagagggtaaaaaatatgatctatatgctttctttt
gacttttattttcaaatgtatgacatgaagaagtgggatcaattttatagtgaagttcta
ggaagacccactacattatctgagacaatggggaaagctgacatatggcttattcgaaac
tcctggaattttcagtttccacatccactcttaccaaatgttgattttgttggaggactc
cactgcaaacctgccaaacccctacctaaggaaatggaagagtttgtacagagctctgga
gaaaatggtattgtggtgttttctctggggtcaatggtcactaacatggaagaagaaagg
gccaacgtaattgcatcagcccttgcccagatcccacaaaaggttctgtggagatttgat
gggaaaaaaccggataccttaggcctcaatactcggctctataagtggataccccagaat
gaccttctaggtcatccaaaaaccagagcttttataactcacggtggagccaatggcatc
tacgaagcgatctaccatggggtccctatggtgggcattccattgtttgccgatcagcct
gataacattgctcacatgaagaccaaaggagcagctgttagattggactttgacacaatg
tcgagtacagacttggcgaatgcactgaagacagtaattaatgatcctttatataaagag
aatgttatgaaattatcaagaattcaacatgatcaaccagtgaagcccctggatcgagca
gtcttctggattgaatttgtcatgcgccacaaaggagctaaacaccttcggcctgcagcc
catgacctcacctggttccagtatcactctttggatgtgattgggttcctgctggcctgt
gtggcaactgtgatacttgttatcatgaaatgttgtctgctttgtttctggaagtttgct
agaaaaggaaagaagggaaaaagtgattag

DBGET integrated database retrieval system