KEGG   Macaca mulatta (rhesus monkey): 677693Help
Entry
677693            CDS       T01028                                 

Gene name
NLK
Definition
nemo-like kinase
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    677693 (NLK)
   04310 Wnt signaling pathway
    677693 (NLK)
   04068 FoxO signaling pathway
    677693 (NLK)
 Cellular Processes
  Cell communication
   04520 Adherens junction
    677693 (NLK)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     677693 (NLK)
Protein kinases [BR:mcc01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   677693 (NLK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
16
AA seq 585 aa AA seqDB search
MSLCGARANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAAA
VHPVQQHTSSAAAAAAAAAAAAAMLNPGQQQPYFPSPAPGQAPGPAAAAPAQVQAAAAAT
VKAHHHQHSHHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
RVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDH
VKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQE
VVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTP
SLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKD
ALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEI
IHQFILEQQKGNRVPLCINPQSAAFKSFIRGNSSGKVQPFMKNSPVVTFRFLDLLPPSEL
HAPSSDFLRMTQVIGGVKPRFPTQSPKETEIPFMELEILEIWEFR
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgtctctttgtggcgcaagagccaacgcaaaaatgatggcggcttacaatggcggtaca
tctgcagcagcagcaggtcaccaccaccaccatcaccaccaccttccacacctccctcct
cctcacctgcaccaccaccaccaccctcaacaccatcttcatccggggtcggctgccgct
gtacaccctgtacagcagcacacctcttcggcagctgcggcagccgcagcagcggctgca
gctgcagccatgttaaaccctgggcaacaacagccatatttcccatcaccggcaccgggg
caggctcctggaccagctgcagcagccccagctcaggtacaggctgccgcagctgctaca
gttaaggcgcaccatcatcagcactcgcatcatccacaacagcagctggatattgagccg
gatagacctattggatatggagcctttggtgttgtctggtcagtaacagatccaagagat
ggaaagagagtagcactcaaaaagatgcccaacgtcttccagaatctggtctcttgcaaa
agggtcttccgggaattgaagatgttgtgtttttttaagcatgataatgtactctctgcc
cttgacatactccaacctccacacattgactattttgaagaaatatatgttgtcacagaa
ttgatgcagagtgacctacataaaattatcgtctctcctcaaccactcagctcagatcat
gtcaaagtttttctttatcagattttgcgaggtttgaaatatctccattcagctggcatt
ttacatcgagacattaagccagggaatctccttgtgaacagcaactgtgttctaaagatt
tgtgattttggattggccagagtggaagaattagatgaatcccgtcatatgactcaggaa
gttgttactcagtattaccgggctccggaaatcctgatgggcagccgtcattacagcaat
gctattgacatctggtctgtgggatgtatctttgcagaactactaggacgaagaatattg
tttcaggcacagagtcccattcagcagttggatttgatcacggatctgttgggcacacca
tcactggaagcaatgaggacagcttgtgaaggcgctaaggcacatatactcaggggtcct
cataaacagccatctcttcctgtactctataccctgtctagccaggctacacatgaagct
gttcatctcctttgcaggatgttggtctttgatccatccaaaagaatatccgctaaggat
gccttagcccacccctacctagatgaagggcgactacgatatcacacatgtatgtgtaaa
tgttgcttttccacctctactggaagagtttataccagtgactttgagcctgttaccaat
cccaaatttgatgacacttttgagaagaacctcagttctgtccgacaggttaaagaaatt
attcatcagttcattttggaacagcagaaaggaaacagagtgcctctctgcatcaaccct
cagtctgctgcttttaagagctttattaggggaaactcatccggtaaagttcagcccttt
atgaagaattcccctgtggtcacattccgattcctggacctgctgccaccctcagagctg
catgctccttcttcagactttctaagaatgactcaggtcattggtggagtgaagccaaga
tttccaactcagtcacccaaagagacggagataccattcatggagctggagatcctggag
atttgggaattcagataa

DBGET integrated database retrieval system