KEGG   Macaca mulatta (rhesus monkey): 678670Help
Entry
678670            CDS       T01028                                 

Gene name
CYP3A4, CYP3A64
Definition
cytochrome P450 3A64
Orthology
K17689  
cytochrome P450, family 3, subfamily A, polypeptide 4 [EC:1.14.13.32 1.14.13.67 1.14.13.97 1.14.13.157 1.14.13.-]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    678670 (CYP3A4)
   00591 Linoleic acid metabolism
    678670 (CYP3A4)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    678670 (CYP3A4)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    678670 (CYP3A4)
   00982 Drug metabolism - cytochrome P450
    678670 (CYP3A4)
   00983 Drug metabolism - other enzymes
    678670 (CYP3A4)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    678670 (CYP3A4)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.32  albendazole monooxygenase
     678670 (CYP3A4)
    1.14.13.67  quinine 3-monooxygenase
     678670 (CYP3A4)
    1.14.13.97  taurochenodeoxycholate 6alpha-hydroxylase
     678670 (CYP3A4)
    1.14.13.157  1,8-cineole 2-exo-monooxygenase
     678670 (CYP3A4)
    1.14.13.-  
     678670 (CYP3A4)
Cytochrome P450 [BR:mcc00199]
 Cytochrome P450, animal type
  CYP3 family
   678670 (CYP3A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 503 aa AA seqDB search
MDLIPDLAVETWLLLAVTLVLLYLYGTHSHGLFKKLGIPGPTPLPLLGNILSYRKGFWTF
DMECYKKYGKVWGFYDGRQPVLAITDPNMIKTVLVKECYSVFTNRRPFGPVGFMKNAISI
AEDEEWKRIRSLLSPTFTSGKLKEMVPIIAKYGDVLVRNLRREAETGKPVTLKDVFGAYS
MDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITIFPFIIPILEVLNISI
FPREVTSFLRKSVKRIKESRLKDTQKHRVDFLQLMIDSQNSKETESHKALSDQELVAQSI
IFIFAGYETTSSVLSFIIYELATHPDVQQKLQEEIDTVLPNKAPPTYDTVLQMEYLDMVV
NETLRIFPIAMRLERVCKKDVEINGIFIPKGVVVMIPSYALHHDPKYWPEPEKFLPERFS
KKNNDNIDPYIYTPFGSGPRNCIGMRFALMNMKLAIIRVLQNFSFKPCKETQIPLKLRLG
GLLQTEKPIVLKIESRDGTVSGA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggatctcatcccagacttggctgtggaaacctggcttctcttggctgtcaccctggtg
ctcctctatttatatggaacccattcacatggactttttaagaagcttggaattccaggg
cccacacctttgcctttattgggaaacattttgtcctaccgtaagggcttttggacgttt
gatatggaatgttataaaaagtatggaaaagtgtggggcttttatgatggtcgacagcct
gtgctggctatcacagatcccaacatgatcaaaacagtgctagtgaaagaatgttattct
gtcttcacaaaccggaggccttttggtccagtgggatttatgaaaaatgccatctctata
gctgaggatgaagaatggaagagaatacggtcattgctctctccaaccttcaccagcgga
aaactcaaggagatggtccctatcattgccaagtatggagatgtgttggtgagaaatctg
aggcgggaagcagagacaggcaagcctgtcaccttgaaagatgtctttggggcctacagc
atggacgtgatcactagcacatcatttggagtgaatatcgactctctcaacaatccacaa
gacccctttgtggaaaacaccaagaagcttttaagatttgatttcttagatccattcttt
ctctcaataacaatcttcccatttatcatcccaattcttgaagtattaaatatctctatt
tttccaagagaagttacaagttttttaagaaaatctgtaaaaaggataaaagaaagtcgc
ctcaaagatacacaaaagcaccgagtggatttccttcagctgatgattgactctcagaat
tcgaaagaaactgagtcccacaaagctctgtctgatcaggagctcgtggcccaatcaatt
atcttcatttttgctggctatgaaaccaccagcagtgttctttccttcattatatatgag
ctggccactcaccctgatgtccagcagaaactgcaggaggaaattgatacagttttaccc
aataaggcaccacccacctatgatactgtgctacagatggagtatctcgacatggtggtg
aatgaaacgctcagaatattcccaattgctatgagacttgagagggtctgcaaaaaagat
gttgaaatcaatgggatattcatacccaaaggggtggtggtgatgattccaagctatgct
cttcatcatgacccaaagtactggccagagcctgagaagttcctccctgaaaggttcagc
aagaagaacaatgacaacatagatccttacatatacacgccctttggaagtggacccaga
aactgcattggcatgaggtttgctctcatgaacatgaaacttgctataatcagagtcctt
cagaacttctccttcaaaccttgtaaagaaacacagatcccactgaaattacgcttagga
ggacttcttcaaacagaaaaacccattgttctaaagattgagtcaagggatgggaccgta
agtggagcctga

DBGET integrated database retrieval system