KEGG   Macaca mulatta (rhesus monkey): 678670Help
Entry
678670            CDS       T01028                                 

Gene name
CYP3A4, CYP3A64
Definition
cytochrome P450 3A64
Orthology
K17689  
cytochrome P450, family 3, subfamily A, polypeptide 4 [EC:1.14.13.32 1.14.13.67 1.14.13.97 1.14.13.157 1.14.13.-]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:mcc00140]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:mcc00591]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:mcc00830]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:mcc00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:mcc00982]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:mcc00983]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:mcc05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 503 aa AA seqDB search
MDLIPDLAVETWLLLAVTLVLLYLYGTHSHGLFKKLGIPGPTPLPLLGNILSYRKGFWTF
DMECYKKYGKVWGFYDGRQPVLAITDPNMIKTVLVKECYSVFTNRRPFGPVGFMKNAISI
AEDEEWKRIRSLLSPTFTSGKLKEMVPIIAKYGDVLVRNLRREAETGKPVTLKDVFGAYS
MDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITIFPFIIPILEVLNISI
FPREVTSFLRKSVKRIKESRLKDTQKHRVDFLQLMIDSQNSKETESHKALSDQELVAQSI
IFIFAGYETTSSVLSFIIYELATHPDVQQKLQEEIDTVLPNKAPPTYDTVLQMEYLDMVV
NETLRIFPIAMRLERVCKKDVEINGIFIPKGVVVMIPSYALHHDPKYWPEPEKFLPERFS
KKNNDNIDPYIYTPFGSGPRNCIGMRFALMNMKLAIIRVLQNFSFKPCKETQIPLKLRLG
GLLQTEKPIVLKIESRDGTVSGA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggatctcatcccagacttggctgtggaaacctggcttctcttggctgtcaccctggtg
ctcctctatttatatggaacccattcacatggactttttaagaagcttggaattccaggg
cccacacctttgcctttattgggaaacattttgtcctaccgtaagggcttttggacgttt
gatatggaatgttataaaaagtatggaaaagtgtggggcttttatgatggtcgacagcct
gtgctggctatcacagatcccaacatgatcaaaacagtgctagtgaaagaatgttattct
gtcttcacaaaccggaggccttttggtccagtgggatttatgaaaaatgccatctctata
gctgaggatgaagaatggaagagaatacggtcattgctctctccaaccttcaccagcgga
aaactcaaggagatggtccctatcattgccaagtatggagatgtgttggtgagaaatctg
aggcgggaagcagagacaggcaagcctgtcaccttgaaagatgtctttggggcctacagc
atggacgtgatcactagcacatcatttggagtgaatatcgactctctcaacaatccacaa
gacccctttgtggaaaacaccaagaagcttttaagatttgatttcttagatccattcttt
ctctcaataacaatcttcccatttatcatcccaattcttgaagtattaaatatctctatt
tttccaagagaagttacaagttttttaagaaaatctgtaaaaaggataaaagaaagtcgc
ctcaaagatacacaaaagcaccgagtggatttccttcagctgatgattgactctcagaat
tcgaaagaaactgagtcccacaaagctctgtctgatcaggagctcgtggcccaatcaatt
atcttcatttttgctggctatgaaaccaccagcagtgttctttccttcattatatatgag
ctggccactcaccctgatgtccagcagaaactgcaggaggaaattgatacagttttaccc
aataaggcaccacccacctatgatactgtgctacagatggagtatctcgacatggtggtg
aatgaaacgctcagaatattcccaattgctatgagacttgagagggtctgcaaaaaagat
gttgaaatcaatgggatattcatacccaaaggggtggtggtgatgattccaagctatgct
cttcatcatgacccaaagtactggccagagcctgagaagttcctccctgaaaggttcagc
aagaagaacaatgacaacatagatccttacatatacacgccctttggaagtggacccaga
aactgcattggcatgaggtttgctctcatgaacatgaaacttgctataatcagagtcctt
cagaacttctccttcaaaccttgtaaagaaacacagatcccactgaaattacgcttagga
ggacttcttcaaacagaaaaacccattgttctaaagattgagtcaagggatgggaccgta
agtggagcctga

DBGET integrated database retrieval system