KEGG   Macaca mulatta (rhesus monkey): 678683Help
Entry
678683            CDS       T01028                                 

Gene name
CYP2C8, CYP2C74
Definition
cytochrome P450, family 2, subfamily C, polypeptide 8 (EC:1.14.14.1)
Orthology
K17718  
cytochrome P450, family 2, subfamily C, polypeptide 8 [EC:1.14.14.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Serotonergic synapse
Chemical carcinogenesis
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:mcc00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:mcc00591]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:mcc00830]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:mcc00982]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:mcc04726]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:mcc05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 490 aa AA seqDB search
MDPFVVLVLCLSFVLLFSLWRQSSGRRKLPPGPTPLPIIGNILQIDVKDICKSFSNFSKV
YGPVFTVYFGMNPVVVLHGYETVKEALIDNAEEFSGRGILPISERITNGLGIISSNGKRW
KETRRFSLTTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICS
VVFQKRFDYKDENFLTLMKRFTVNFRILTSPWIQVCNNFPLLIDCFPGTHNKLLKNVALT
KSYIREKVKEHQATLDVNNPRDFIDCFLIKMEQEKDNQESEFTIENLVGTVADLFVAGTE
TTSTTLRYGLLLLLKHPEVTVKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVIHEIQRYID
LVPTGVPHAVTTDIKFRNYLIPKGTIIITLLTSVLHDDKEFPNPKIFDPGHFLDENGNFK
KSDYFMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVADLKNLNTTSATRGIISLP
PSYQICFIPV
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggatccttttgtggtcctcgtgctctgtctctcctttgtgcttctcttttcactctgg
agacagagctctgggagaaggaagctccctcctggccccactcctcttcctattattgga
aatattctacagatagatgttaaggacatctgcaaatctttcagcaatttctcaaaagtc
tatggtcctgtgttcaccgtgtattttggcatgaatcctgtagtggtgttgcatggatat
gagacagtgaaggaagccctgattgataatgcagaggagttttctggaagaggcattttg
ccaatatctgaaagaattactaacggacttggaatcatttccagcaatggaaagagatgg
aaggagacccgtcgtttctctctcacaaccttgcggaattttgggatggggaagaggagc
attgaggaccgtgttcaagaggaagcccgctgccttgtggaggagttgagaaaaaccaag
gcctcaccctgtgatcccactttcatcctgggctgtgctccctgcaatgtgatctgctcc
gttgttttccagaaacgatttgattataaagatgagaattttctcaccctgatgaaaaga
ttcactgtaaacttcaggattctgacctccccatggatccaggtctgcaataatttccct
ctactcattgattgtttcccaggaactcacaacaaattgcttaaaaatgttgctcttaca
aaaagttacattagggagaaagtaaaagaacaccaagcaacactggatgttaacaatcct
cgggactttatcgattgcttcctgatcaaaatggagcaggaaaaggacaaccaagagtca
gaattcactattgaaaacttggttggcactgtagctgatctatttgttgctggaacagag
acaacaagcaccactctgagatatggactcctgctcctgctgaagcacccagaggtcaca
gttaaagtccaggaagaaattgatcatgtaattggcagacacaggagcccctgcatgcag
gataggagccacatgccttacacagatgctgtaatacacgagatccagagatacattgac
cttgtccccaccggcgtaccccacgcagtgaccactgatattaagttcagaaactacctc
atccccaagggcacaatcataataacattactcacttccgtgctgcacgatgacaaagaa
ttccctaatccaaagatctttgaccctggccactttctggatgagaatggcaactttaag
aaaagtgactacttcatgcctttctcagcaggaaaacgaatttgtgcaggagagggactt
gcccgcatggagctatttttatttctaaccacaattttacagaactttaacctgaaatct
gttgctgatttaaagaacctcaatactacttcagctactagagggattatttctctgcca
ccctcgtaccagatctgcttcattcctgtctga

DBGET integrated database retrieval system