KEGG   Macaca mulatta (rhesus monkey): 678683Help
Entry
678683            CDS       T01028                                 

Gene name
CYP2C8, CYP2C74
Definition
cytochrome P450, family 2, subfamily C, polypeptide 8 (EC:1.14.14.1)
Orthology
K17718  
cytochrome P450, family 2, subfamily C, polypeptide 8 [EC:1.14.14.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Serotonergic synapse
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    678683 (CYP2C8)
   00591 Linoleic acid metabolism
    678683 (CYP2C8)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    678683 (CYP2C8)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    678683 (CYP2C8)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    678683 (CYP2C8)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    678683 (CYP2C8)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     678683 (CYP2C8)
Cytochrome P450 [BR:mcc00199]
 Cytochrome P450, animal type
  CYP2 family
   678683 (CYP2C8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 490 aa AA seqDB search
MDPFVVLVLCLSFVLLFSLWRQSSGRRKLPPGPTPLPIIGNILQIDVKDICKSFSNFSKV
YGPVFTVYFGMNPVVVLHGYETVKEALIDNAEEFSGRGILPISERITNGLGIISSNGKRW
KETRRFSLTTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICS
VVFQKRFDYKDENFLTLMKRFTVNFRILTSPWIQVCNNFPLLIDCFPGTHNKLLKNVALT
KSYIREKVKEHQATLDVNNPRDFIDCFLIKMEQEKDNQESEFTIENLVGTVADLFVAGTE
TTSTTLRYGLLLLLKHPEVTVKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVIHEIQRYID
LVPTGVPHAVTTDIKFRNYLIPKGTIIITLLTSVLHDDKEFPNPKIFDPGHFLDENGNFK
KSDYFMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVADLKNLNTTSATRGIISLP
PSYQICFIPV
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggatccttttgtggtcctcgtgctctgtctctcctttgtgcttctcttttcactctgg
agacagagctctgggagaaggaagctccctcctggccccactcctcttcctattattgga
aatattctacagatagatgttaaggacatctgcaaatctttcagcaatttctcaaaagtc
tatggtcctgtgttcaccgtgtattttggcatgaatcctgtagtggtgttgcatggatat
gagacagtgaaggaagccctgattgataatgcagaggagttttctggaagaggcattttg
ccaatatctgaaagaattactaacggacttggaatcatttccagcaatggaaagagatgg
aaggagacccgtcgtttctctctcacaaccttgcggaattttgggatggggaagaggagc
attgaggaccgtgttcaagaggaagcccgctgccttgtggaggagttgagaaaaaccaag
gcctcaccctgtgatcccactttcatcctgggctgtgctccctgcaatgtgatctgctcc
gttgttttccagaaacgatttgattataaagatgagaattttctcaccctgatgaaaaga
ttcactgtaaacttcaggattctgacctccccatggatccaggtctgcaataatttccct
ctactcattgattgtttcccaggaactcacaacaaattgcttaaaaatgttgctcttaca
aaaagttacattagggagaaagtaaaagaacaccaagcaacactggatgttaacaatcct
cgggactttatcgattgcttcctgatcaaaatggagcaggaaaaggacaaccaagagtca
gaattcactattgaaaacttggttggcactgtagctgatctatttgttgctggaacagag
acaacaagcaccactctgagatatggactcctgctcctgctgaagcacccagaggtcaca
gttaaagtccaggaagaaattgatcatgtaattggcagacacaggagcccctgcatgcag
gataggagccacatgccttacacagatgctgtaatacacgagatccagagatacattgac
cttgtccccaccggcgtaccccacgcagtgaccactgatattaagttcagaaactacctc
atccccaagggcacaatcataataacattactcacttccgtgctgcacgatgacaaagaa
ttccctaatccaaagatctttgaccctggccactttctggatgagaatggcaactttaag
aaaagtgactacttcatgcctttctcagcaggaaaacgaatttgtgcaggagagggactt
gcccgcatggagctatttttatttctaaccacaattttacagaactttaacctgaaatct
gttgctgatttaaagaacctcaatactacttcagctactagagggattatttctctgcca
ccctcgtaccagatctgcttcattcctgtctga

DBGET integrated database retrieval system