KEGG   Macaca mulatta (rhesus monkey): 678686Help
Entry
678686            CDS       T01028                                 

Gene name
CYP2C75
Definition
cytochrome P450, family 2, subfamily C, polypeptide 75
Orthology
K07413  
cytochrome P450, family 2, subfamily C [EC:1.14.14.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Chemical carcinogenesis
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:mcc00140]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:mcc00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:mcc00591]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:mcc00830]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:mcc04726]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:mcc04750]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:mcc05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 490 aa AA seqDB search
MDSLVVLVLCLSCLLLLSLWRQRSGRGKFPPGPTPLPVIGNILQIDIKDVSKSLTNLSKV
YGPVFTLYFGLERMVVLHGYEAVKEALIDLGEEFSGRGHFPLADRANRGFGIVFSNGKRW
KEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKGSPCDPTFILGCAPCNVICS
IIFHKRFDYKDQQFLKVMEKLNENVKILSSPWIQICNNFPPFIDYFPGAHNKLLKNIAFL
KSYILEKVKEHQESMDMNNPRDFIDCFLMKMEKEKHNQQSEFTIENLENTAVDLFGAGTE
TTSTTLRYALLLLLKHPEVTAKVQEEIERVIGRNRSPCMQDRSHMPYTDAVVHEIQRYID
LLPTNLPHAVTCDVKFRNYLIPKGTTILISLTSVLHDNKEFPNPEMFDPRHFLDEGGNFK
KSNYFMPFSAGKRICVGEALARMELFLFLTSVLQNFNLKSLVDPKDLDTTPVVNGFASVP
PFYQLCFIPV
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggattctcttgtggtccttgtgctctgtctctcctgtttgcttctcctttcactctgg
agacagagatctgggagaggaaaattccctcctggccccactcctctcccagtgattgga
aatatcctacagatagatattaaggacgtcagcaaatccttaaccaacctctcaaaagtc
tatggccctgtgttcactctgtattttggcctggaacgcatggtggtgctgcatggatat
gaagcagtgaaggaagccctgattgatcttggagaggagttttctggaagaggacatttt
ccattggctgacagagctaacagaggatttggaatcgttttcagcaatggaaagagatgg
aaggagatccggcgtttttccctcatgacactgcggaattttgggatggggaagaggagc
attgaggatcgtgttcaagaggaagcccgctgccttgtggaggagttgagaaaaaccaag
ggctcaccctgtgatcccactttcatcctgggctgtgctccctgcaatgtgatctgctcc
attattttccataaacgttttgattataaagatcagcaatttcttaaagtgatggaaaaa
ttgaatgaaaacgtcaagattttgagcagcccctggatccagatatgcaataattttcct
cctttcattgattatttcccgggagcccataacaaattacttaaaaacattgcttttttg
aaaagttatattttggagaaagtaaaagaacaccaagaatcaatggacatgaacaaccct
cgggactttattgattgcttcctgatgaaaatggagaaggaaaagcacaaccaacagtct
gaatttactattgaaaacttggaaaacactgcagttgacttgtttggagctgggacagag
acgacaagcacaaccctgagatatgctctccttctcctgctgaagcacccagaggtcaca
gctaaagtccaggaagagattgaacgtgtgattggcagaaatcggagcccctgcatgcag
gacaggagccacatgccctacacagatgctgtggtgcacgagatccagagatacattgac
cttctccccaccaacctgccccatgcagtgacctgtgatgttaaattcagaaactacctc
atccccaagggcacaaccatattaatttccctgacttctgtgctacatgacaacaaagaa
tttcccaacccagagatgtttgaccctcgtcactttctggacgaaggtggcaattttaag
aaaagtaactacttcatgcctttctcagcaggaaaacggatttgtgtgggagaagccctg
gcccgcatggagctgtttttattcttgacctccgttttacagaactttaacctgaaatct
ctggttgacccaaaggaccttgacaccactccagttgtcaatgggtttgcctctgtgcca
cccttctaccagctgtgcttcattcctgtttga

DBGET integrated database retrieval system