KEGG   Macaca mulatta (rhesus monkey): 678686Help
Entry
678686            CDS       T01028                                 

Gene name
CYP2C75
Definition
cytochrome P450, family 2, subfamily C, polypeptide 75
Orthology
K07413  
cytochrome P450, family 2, subfamily C [EC:1.14.14.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    678686 (CYP2C75)
   00590 Arachidonic acid metabolism
    678686 (CYP2C75)
   00591 Linoleic acid metabolism
    678686 (CYP2C75)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    678686 (CYP2C75)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    678686 (CYP2C75)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    678686 (CYP2C75)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    678686 (CYP2C75)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     678686 (CYP2C75)
Cytochrome P450 [BR:mcc00199]
 Cytochrome P450, animal type
  CYP2 family
   678686 (CYP2C75)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 490 aa AA seqDB search
MDSLVVLVLCLSCLLLLSLWRQRSGRGKFPPGPTPLPVIGNILQIDIKDVSKSLTNLSKV
YGPVFTLYFGLERMVVLHGYEAVKEALIDLGEEFSGRGHFPLADRANRGFGIVFSNGKRW
KEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKGSPCDPTFILGCAPCNVICS
IIFHKRFDYKDQQFLKVMEKLNENVKILSSPWIQICNNFPPFIDYFPGAHNKLLKNIAFL
KSYILEKVKEHQESMDMNNPRDFIDCFLMKMEKEKHNQQSEFTIENLENTAVDLFGAGTE
TTSTTLRYALLLLLKHPEVTAKVQEEIERVIGRNRSPCMQDRSHMPYTDAVVHEIQRYID
LLPTNLPHAVTCDVKFRNYLIPKGTTILISLTSVLHDNKEFPNPEMFDPRHFLDEGGNFK
KSNYFMPFSAGKRICVGEALARMELFLFLTSVLQNFNLKSLVDPKDLDTTPVVNGFASVP
PFYQLCFIPV
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggattctcttgtggtccttgtgctctgtctctcctgtttgcttctcctttcactctgg
agacagagatctgggagaggaaaattccctcctggccccactcctctcccagtgattgga
aatatcctacagatagatattaaggacgtcagcaaatccttaaccaacctctcaaaagtc
tatggccctgtgttcactctgtattttggcctggaacgcatggtggtgctgcatggatat
gaagcagtgaaggaagccctgattgatcttggagaggagttttctggaagaggacatttt
ccattggctgacagagctaacagaggatttggaatcgttttcagcaatggaaagagatgg
aaggagatccggcgtttttccctcatgacactgcggaattttgggatggggaagaggagc
attgaggatcgtgttcaagaggaagcccgctgccttgtggaggagttgagaaaaaccaag
ggctcaccctgtgatcccactttcatcctgggctgtgctccctgcaatgtgatctgctcc
attattttccataaacgttttgattataaagatcagcaatttcttaaagtgatggaaaaa
ttgaatgaaaacgtcaagattttgagcagcccctggatccagatatgcaataattttcct
cctttcattgattatttcccgggagcccataacaaattacttaaaaacattgcttttttg
aaaagttatattttggagaaagtaaaagaacaccaagaatcaatggacatgaacaaccct
cgggactttattgattgcttcctgatgaaaatggagaaggaaaagcacaaccaacagtct
gaatttactattgaaaacttggaaaacactgcagttgacttgtttggagctgggacagag
acgacaagcacaaccctgagatatgctctccttctcctgctgaagcacccagaggtcaca
gctaaagtccaggaagagattgaacgtgtgattggcagaaatcggagcccctgcatgcag
gacaggagccacatgccctacacagatgctgtggtgcacgagatccagagatacattgac
cttctccccaccaacctgccccatgcagtgacctgtgatgttaaattcagaaactacctc
atccccaagggcacaaccatattaatttccctgacttctgtgctacatgacaacaaagaa
tttcccaacccagagatgtttgaccctcgtcactttctggacgaaggtggcaattttaag
aaaagtaactacttcatgcctttctcagcaggaaaacggatttgtgtgggagaagccctg
gcccgcatggagctgtttttattcttgacctccgttttacagaactttaacctgaaatct
ctggttgacccaaaggaccttgacaccactccagttgtcaatgggtttgcctctgtgcca
cccttctaccagctgtgcttcattcctgtttga

DBGET integrated database retrieval system