KEGG   Macaca mulatta (rhesus monkey): 678687Help
Entry
678687            CDS       T01028                                 

Gene name
CYP2B6, CYP2B30
Definition
(RefSeq) cytochrome P450, family 2, subfamily B, polypeptide 6
  KO
K17709  cytochrome P450 family 2 subfamily B polypeptide 6 [EC:1.14.13.-]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00590  Arachidonic acid metabolism
mcc00830  Retinol metabolism
mcc00980  Metabolism of xenobiotics by cytochrome P450
mcc00982  Drug metabolism - cytochrome P450
mcc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    678687 (CYP2B6)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    678687 (CYP2B6)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    678687 (CYP2B6)
   00982 Drug metabolism - cytochrome P450
    678687 (CYP2B6)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.-  
     678687 (CYP2B6)
Cytochrome P450 [BR:mcc00199]
 Cytochrome P450, animal type
  CYP2 family
   678687 (CYP2B6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 678687
NCBI-ProteinID: NP_001035302
Ensembl: ENSMMUG00000018363
UniProt: Q6GUQ8
Position
19
AA seq 491 aa AA seqDB search
MELSVLLFLALLTGLLLLLVQRHPNAHGRLPPGPCPLPLLGNLLQMDRRGLLRSFLRFRE
KYGDVFTVYLGPRPVVMLCGVEAIREALVDNAEAFSGRGKIAITDPVFQGYGVVFANGNR
WKVLRRFSLTTMRDFGMGKRSVEERIQEEAQCLIEELRKSKGALVDPTFLFHSITANIIC
SIVFGKRFHYQDQEFLKILNLFYHTFSLASSMFGQLFELLSGFLKYFPGAHRQVYKNLQE
INAYIGHSVEKHRETLDPSAPQDLIDSYLLQMEKEKSNPHSEFSHRNLIINTLSLFFAGT
ETTSTTLRYGFLLMLKYPHVAERIYKEIEQVIGPHRPPALDDRAKMPYTEAVIHEIQRFA
DLLPMGVPHIVTQQTSFRGYIIPKDTEVFPLLSTALHDPHYFEKPDTFNPDHFLDANGAL
KKNEAFIPFSLGRRMCLGEGIARNELFLFFTTILQNFSVASPVAPEDIDLTPQESGVGKI
PPTYQIRFLPR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggaactcagcgtcctcctcttccttgcactccttacaggcctcctgctactcctggtt
cagcgccaccctaacgcccatggccgcctcccaccaggtccctgccctctgccccttttg
ggaaaccttctgcagatggacagaagaggcctactcagatcctttctgaggttccgagag
aaatatggggacgtcttcacagtatacctgggaccgaggcccgtggtcatgctgtgtgga
gtagaggccatacgggaggccctggtggacaacgctgaggccttctctggccggggaaaa
atcgccatcactgacccagtattccagggatatggcgttgtctttgccaatggaaaccgc
tggaaggtgcttcggcgattctctctgaccaccatgagggactttgggatgggaaagcgg
agtgtggaggagcggattcaggaggaggctcagtgtctgatagaggagcttcggaaatcc
aagggagccctcgtggaccccaccttcctcttccattccattaccgccaacatcatctgc
tccatcgtctttggaaaacgcttccactaccaagatcaagagttcctgaagatactgaac
ttgttctaccacactttctcactcgccagttctatgttcggccagctgtttgagctcttg
tctggcttcttgaaatactttcctggggcacacaggcaagtctacaaaaacctgcaggaa
atcaatgcttatattggccacagtgtggagaagcaccgtgaaaccctggaccccagcgcc
ccccaggacctcatcgacagctacctgctccaaatggaaaaagagaaatccaacccacac
agtgaattcagccaccggaacctcatcatcaacacgctctcgctcttctttgctggcact
gagaccaccagcaccactctccgctacggcttcctgctcatgctcaaataccctcacgtc
gcagagagaatctacaaggagattgaacaggtgattggcccacatcgccctccagcgctt
gatgaccgagccaaaatgccatacacagaggcagtcatccatgagattcagagatttgcc
gaccttctccccatgggtgtgccccacattgtcacacaacagaccagcttccgagggtac
atcatccccaaggacacggaagtatttcccctcctgagtactgctctccatgacccacac
tactttgagaaaccagacaccttcaatcctgaccactttctggatgccaatggggcattg
aagaagaatgaagcttttatccccttctccttagggaggcggatgtgccttggtgaaggc
atcgcccgcaatgaattgttcctcttcttcaccaccatcctccagaacttctccgtggcc
agccctgtggctcctgaagacatcgatctgacaccccaggagagtggtgtgggcaaaata
cccccaacgtaccagatccgcttcctgccccgctga

DBGET integrated database retrieval system