KEGG   Macaca mulatta (rhesus monkey): 678687Help
Entry
678687            CDS       T01028                                 

Gene name
CYP2B6, CYP2B30
Definition
cytochrome P450, family 2, subfamily B, polypeptide 6 (EC:1.14.14.1)
Orthology
K17709  
cytochrome P450, family 2, subfamily B, polypeptide 6 [EC:1.14.13.-]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Arachidonic acid metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:mcc00590]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:mcc00830]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:mcc00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:mcc00982]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
19
AA seq 491 aa AA seqDB search
MELSVLLFLALLTGLLLLLVQRHPNAHGRLPPGPCPLPLLGNLLQMDRRGLLRSFLRFRE
KYGDVFTVYLGPRPVVMLCGVEAIREALVDNAEAFSGRGKIAITDPVFQGYGVVFANGNR
WKVLRRFSLTTMRDFGMGKRSVEERIQEEAQCLIEELRKSKGALVDPTFLFHSITANIIC
SIVFGKRFHYQDQEFLKILNLFYHTFSLASSMFGQLFELLSGFLKYFPGAHRQVYKNLQE
INAYIGHSVEKHRETLDPSAPQDLIDSYLLQMEKEKSNPHSEFSHRNLIINTLSLFFAGT
ETTSTTLRYGFLLMLKYPHVAERIYKEIEQVIGPHRPPALDDRAKMPYTEAVIHEIQRFA
DLLPMGVPHIVTQQTSFRGYIIPKDTEVFPLLSTALHDPHYFEKPDTFNPDHFLDANGAL
KKNEAFIPFSLGRRMCLGEGIARNELFLFFTTILQNFSVASPVAPEDIDLTPQESGVGKI
PPTYQIRFLPR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggaactcagcgtcctcctcttccttgcactccttacaggcctcctgctactcctggtt
cagcgccaccctaacgcccatggccgcctcccaccaggtccctgccctctgccccttttg
ggaaaccttctgcagatggacagaagaggcctactcagatcctttctgaggttccgagag
aaatatggggacgtcttcacagtatacctgggaccgaggcccgtggtcatgctgtgtgga
gtagaggccatacgggaggccctggtggacaacgctgaggccttctctggccggggaaaa
atcgccatcactgacccagtattccagggatatggcgttgtctttgccaatggaaaccgc
tggaaggtgcttcggcgattctctctgaccaccatgagggactttgggatgggaaagcgg
agtgtggaggagcggattcaggaggaggctcagtgtctgatagaggagcttcggaaatcc
aagggagccctcgtggaccccaccttcctcttccattccattaccgccaacatcatctgc
tccatcgtctttggaaaacgcttccactaccaagatcaagagttcctgaagatactgaac
ttgttctaccacactttctcactcgccagttctatgttcggccagctgtttgagctcttg
tctggcttcttgaaatactttcctggggcacacaggcaagtctacaaaaacctgcaggaa
atcaatgcttatattggccacagtgtggagaagcaccgtgaaaccctggaccccagcgcc
ccccaggacctcatcgacagctacctgctccaaatggaaaaagagaaatccaacccacac
agtgaattcagccaccggaacctcatcatcaacacgctctcgctcttctttgctggcact
gagaccaccagcaccactctccgctacggcttcctgctcatgctcaaataccctcacgtc
gcagagagaatctacaaggagattgaacaggtgattggcccacatcgccctccagcgctt
gatgaccgagccaaaatgccatacacagaggcagtcatccatgagattcagagatttgcc
gaccttctccccatgggtgtgccccacattgtcacacaacagaccagcttccgagggtac
atcatccccaaggacacggaagtatttcccctcctgagtactgctctccatgacccacac
tactttgagaaaccagacaccttcaatcctgaccactttctggatgccaatggggcattg
aagaagaatgaagcttttatccccttctccttagggaggcggatgtgccttggtgaaggc
atcgcccgcaatgaattgttcctcttcttcaccaccatcctccagaacttctccgtggcc
agccctgtggctcctgaagacatcgatctgacaccccaggagagtggtgtgggcaaaata
cccccaacgtaccagatccgcttcctgccccgctga

DBGET integrated database retrieval system