KEGG   Macaca mulatta (rhesus monkey): 678689Help
Entry
678689            CDS       T01028                                 

Gene name
CYP2A24
Definition
cytochrome P450, family 2, subfamily A, polypeptide 24
Orthology
K17685  
cytochrome P450, family 2, subfamily A, polypeptide 13 [EC:1.14.14.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Metabolism of xenobiotics by cytochrome P450
Chemical carcinogenesis
Class
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:mcc00980]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:mcc05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
19
AA seq 494 aa AA seqDB search
MLASGLLLVALLACLTVMVLMSVWQQRNSKGKLPPGPTPLPFIGNYLQLNTEQMCNSLMK
ISERYGPVFTIHLGPRRVVVLCGYDAVKEALVDQAEEFSGRGEQATFDWVFKGYGVVFSN
GERAKQLRRFSIATLRDFGVGKRGIEERIQEEAGFLIEALRDTHGANIDPTFFLSRTVSN
VISSIVFGDRFDYEDKEFLSLLGMMLGSFQFTSTSTGQLYEMFSSVMKHLPGPQQQAFKE
LQGLEDFIAKKVEHNQHTLDPNSPRDFIDSFLIRMQEEEKNPNTEFYLKNLMMTTLNLFI
AGTETVSTTLRYGFLLLMKYPEVEAKVHEEIDRVIGKNRQPKFEDRVKMPYMEAVIHEIQ
RFGDVIPMSLARRVNKDTKFRDFFLPKGTEVFPMLGSVLRDPRFFSNPQDFNPQHFLDEK
GQFKKSDAFVPFSIGKRNCFGEGLARMELFLFFTTIMQNFRFKSPQLPKDIDVSPKHVGF
ATIPPNYTMSFLPR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgctggcctcagggctgctcctggtggccttgctggcctgcctgactgtgatggtcttg
atgtctgtctggcagcagaggaacagcaagggaaagctgcctccgggacccaccccattg
cccttcattggaaactacctgcagctgaacacagagcagatgtgcaactccctcatgaag
atcagtgagcgctatggcccggtgttcaccattcacctggggccccggcgggtggtggtg
ctgtgcggatatgatgccgtcaaggaggctctggtggaccaggctgaggagttcagcggg
cgaggcgagcaggccaccttcgactgggtcttcaaaggctatggcgtggttttcagcaac
ggggagcgcgccaagcagctccggcgcttctccatcgccaccttgcgggacttcggggtg
ggcaagcgcggcatcgaggagcgcatccaggaggaggcaggtttcctcatcgaggccctc
cgggacacgcatggcgccaatatcgatcccaccttcttcctgagtcgcaccgtctctaac
gtcatcagctccattgtctttggggaccgctttgactacgaggacaaagagttcctgtct
ctgctgggcatgatgctgggaagcttccagttcacgtcaacctccacggggcagctctat
gagatgttctcttcagtgatgaaacacctgccaggaccacagcaacaggcctttaaggag
ctgcaagggctggaggacttcatagccaagaaggtggagcacaaccagcacacgctggat
cccaactccccacgggacttcatcgactcctttctcatccgcatgcaggaggaggagaag
aaccccaacacggagttctacttgaagaacctgatgatgaccacgctgaacctcttcatt
gcaggcaccgagaccgtcagcaccaccctgcgctatggcttcctgctgctcatgaagtat
ccagaggtggaggccaaggtccatgaggagattgacagagtgatcggcaagaaccggcag
cccaagtttgaggaccgggtcaagatgccctacatggaggcagtgatccacgagatccaa
agatttggagacgtgatccccatgagcttggcccgcagggtcaacaaggacaccaagttt
cgggatttcttcctccctaagggcaccgaagtgttccctatgctgggctccgtgctgaga
gaccccaggtttttctccaacccccaggacttcaatccccagcacttcctggatgagaag
gggcagtttaagaagagtgacgcttttgtgcccttttccatcggaaagcggaactgtttc
ggagaaggcctggccagaatggagctctttctcttcttcaccaccatcatgcagaacttc
cgcttcaagtccccccagttgcccaaggacatcgacgtgtcccccaaacacgtgggcttt
gccacgatcccaccaaactacaccatgagcttcctgccccgctga

DBGET integrated database retrieval system