KEGG   Macaca mulatta (rhesus monkey): 678689Help
Entry
678689            CDS       T01028                                 

Gene name
CYP2A24
Definition
cytochrome P450, family 2, subfamily A, polypeptide 24
Orthology
K17685  
cytochrome P450, family 2, subfamily A, polypeptide 13 [EC:1.14.14.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Metabolism of xenobiotics by cytochrome P450
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    678689 (CYP2A24)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    678689 (CYP2A24)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     678689 (CYP2A24)
Cytochrome P450 [BR:mcc00199]
 Cytochrome P450, animal type
  CYP2 family
   678689 (CYP2A24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
19
AA seq 494 aa AA seqDB search
MLASGLLLVALLACLTVMVLMSVWQQRNSKGKLPPGPTPLPFIGNYLQLNTEQMCNSLMK
ISERYGPVFTIHLGPRRVVVLCGYDAVKEALVDQAEEFSGRGEQATFDWVFKGYGVVFSN
GERAKQLRRFSIATLRDFGVGKRGIEERIQEEAGFLIEALRDTHGANIDPTFFLSRTVSN
VISSIVFGDRFDYEDKEFLSLLGMMLGSFQFTSTSTGQLYEMFSSVMKHLPGPQQQAFKE
LQGLEDFIAKKVEHNQHTLDPNSPRDFIDSFLIRMQEEEKNPNTEFYLKNLMMTTLNLFI
AGTETVSTTLRYGFLLLMKYPEVEAKVHEEIDRVIGKNRQPKFEDRVKMPYMEAVIHEIQ
RFGDVIPMSLARRVNKDTKFRDFFLPKGTEVFPMLGSVLRDPRFFSNPQDFNPQHFLDEK
GQFKKSDAFVPFSIGKRNCFGEGLARMELFLFFTTIMQNFRFKSPQLPKDIDVSPKHVGF
ATIPPNYTMSFLPR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgctggcctcagggctgctcctggtggccttgctggcctgcctgactgtgatggtcttg
atgtctgtctggcagcagaggaacagcaagggaaagctgcctccgggacccaccccattg
cccttcattggaaactacctgcagctgaacacagagcagatgtgcaactccctcatgaag
atcagtgagcgctatggcccggtgttcaccattcacctggggccccggcgggtggtggtg
ctgtgcggatatgatgccgtcaaggaggctctggtggaccaggctgaggagttcagcggg
cgaggcgagcaggccaccttcgactgggtcttcaaaggctatggcgtggttttcagcaac
ggggagcgcgccaagcagctccggcgcttctccatcgccaccttgcgggacttcggggtg
ggcaagcgcggcatcgaggagcgcatccaggaggaggcaggtttcctcatcgaggccctc
cgggacacgcatggcgccaatatcgatcccaccttcttcctgagtcgcaccgtctctaac
gtcatcagctccattgtctttggggaccgctttgactacgaggacaaagagttcctgtct
ctgctgggcatgatgctgggaagcttccagttcacgtcaacctccacggggcagctctat
gagatgttctcttcagtgatgaaacacctgccaggaccacagcaacaggcctttaaggag
ctgcaagggctggaggacttcatagccaagaaggtggagcacaaccagcacacgctggat
cccaactccccacgggacttcatcgactcctttctcatccgcatgcaggaggaggagaag
aaccccaacacggagttctacttgaagaacctgatgatgaccacgctgaacctcttcatt
gcaggcaccgagaccgtcagcaccaccctgcgctatggcttcctgctgctcatgaagtat
ccagaggtggaggccaaggtccatgaggagattgacagagtgatcggcaagaaccggcag
cccaagtttgaggaccgggtcaagatgccctacatggaggcagtgatccacgagatccaa
agatttggagacgtgatccccatgagcttggcccgcagggtcaacaaggacaccaagttt
cgggatttcttcctccctaagggcaccgaagtgttccctatgctgggctccgtgctgaga
gaccccaggtttttctccaacccccaggacttcaatccccagcacttcctggatgagaag
gggcagtttaagaagagtgacgcttttgtgcccttttccatcggaaagcggaactgtttc
ggagaaggcctggccagaatggagctctttctcttcttcaccaccatcatgcagaacttc
cgcttcaagtccccccagttgcccaaggacatcgacgtgtcccccaaacacgtgggcttt
gccacgatcccaccaaactacaccatgagcttcctgccccgctga

DBGET integrated database retrieval system