KEGG   Macaca mulatta (rhesus monkey): 678691Help
Entry
678691            CDS       T01028                                 

Gene name
CYP2D6, CYP2D42
Definition
cytochrome P450, family 2, subfamily D, polypeptide 6 (EC:1.14.14.1)
Orthology
K17712  
cytochrome P450, family 2, subfamily D, polypeptide 6 [EC:1.14.14.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    678691 (CYP2D6)
   00982 Drug metabolism - cytochrome P450
    678691 (CYP2D6)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    678691 (CYP2D6)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     678691 (CYP2D6)
Cytochrome P450 [BR:mcc00199]
 Cytochrome P450, animal type
  CYP2 family
   678691 (CYP2D6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 497 aa AA seqDB search
MELDALVPLAVIVAIFLLLVDLMHRRQRWAARYPPGPLPLPGLGNLLHVDFKNTPYCFDQ
LRRRFGDVFSLQLAWTPVVVLNGLAAVREALVTCGEDTADRPPVPINQVLGVGPRSQGVF
LARYGPAWREQRRFSVSTLRNLGLGKKSLEQWVTEEAACLCAAFTDQAGRPFRPNSLLDK
AVSNVIASLTYGRRFEYDDPRFLRLFDLTHEALKEESGFLREVLNAVPLLLRIPGLAGKV
LRSQKAFLTQLDELLTEHRMTWDPAQPPRDLTEAFLAEMEKAKGNPESSFNEENLRIVVA
DLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDNVIGQVRRPEMGDQARMPYTTAVI
HEVQRFGDIVPLGVTHMTSRDIELQGFLIPKGTTLFTNLSSVLKDEAVWEKPFRFHPEHF
LDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTCLLQRFSFSVPAGQPRPSHHGV
FAFLVTPSPYELCAVPR
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggagctagatgcactggtgcccctggctgtgatagtggccatcttcctgctcctggtg
gacctgatgcaccggcgccaacgttgggctgcacgctacccgccaggtcccctgccactg
ccagggctgggcaacctgttgcatgtggacttcaagaacacaccatactgcttcgaccag
ttgcggcgccgcttcggggacgtgttcagcctgcagctggcctggacgccggtggtcgtg
ctcaatgggctggcggccgtgcgtgaggcgctggtgacctgcggcgaggacacagccgac
cgcccgcctgtgcccatcaaccaggtcctgggtgttgggccgcgctcccaaggggtgttc
ctggcgcgctacgggcccgcgtggcgcgagcagaggcgcttctccgtgtctaccttgcgc
aacttgggcctgggcaagaagtcgctggagcaatgggtcaccgaggaggccgcctgcctc
tgtgctgccttcaccgaccaagccggacgaccctttcgcccaaacagcctcctggataaa
gcagtgagcaacgtgatcgcctccctcacctacgggcgccgcttcgagtacgacgaccct
cgcttcctcaggctgtttgacctaacacatgaggcactgaaggaggagtcaggcttcctg
cgcgaggtgctgaatgccgtccccctcctcctgcgcatccctgggctggctggcaaggtc
ctacgctcccaaaaggctttcctgacccagctagatgagctgctgaccgagcacaggatg
acctgggacccagcccagccaccccgagacctgactgaggccttcctggcagagatggag
aaggccaaggggaaccctgagagtagcttcaatgaagagaacctgcgcatagtggtggct
gacttgttctctgctgggatggtgaccacctcgaccacgctggcctggggcctcctgctc
atgatcctgcacccggatgtgcagcgccgtgtccaacaggagatcgacaacgtgataggg
caggtgcggcgacctgagatgggtgaccaggctcgcatgccctacaccactgccgtgatt
cacgaggtgcagcgctttggggacatcgtccccctgggtgtgacccatatgacatcccgt
gacatcgaactacagggcttcctcatccctaaggggacgacgctcttcaccaacctgtca
tcggtgctgaaggatgaggccgtctgggagaagcccttccgcttccaccccgaacacttc
ctggatgctcagggccactttgtgaagccagaggccttcctgcctttctcagcaggccgc
cgggcatgcctcggggagcccctggcccgcatggagctcttcctcttcttcacctgcctg
ctgcagcgcttcagcttctcggtgcccgccggacagccccggcccagccaccatggtgtc
tttgctttcctggtgaccccttccccctacgagctttgtgctgtgccccgctag

  All links  
No link information was found.   
DBGET integrated database retrieval system