KEGG   Macaca mulatta (rhesus monkey): 678692Help
Entry
678692            CDS       T01028                                 

Gene name
CYP3A5, CYP3A66
Definition
cytochrome P450, family 3, subfamily A, polypeptide 5 (EC:1.14.14.1)
Orthology
K17690  
cytochrome P450, family 3, subfamily A, polypeptide 5 [EC:1.14.14.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Steroid hormone biosynthesis
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    678692 (CYP3A5)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    678692 (CYP3A5)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    678692 (CYP3A5)
   00982 Drug metabolism - cytochrome P450
    678692 (CYP3A5)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    678692 (CYP3A5)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     678692 (CYP3A5)
Cytochrome P450 [BR:mcc00199]
 Cytochrome P450, animal type
  CYP3 family
   678692 (CYP3A5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 503 aa AA seqDB search
MDLIPNLAMETWLLLAVSLVLLYLYGTRSYGLFKRQGIPGPTPLPFLGNILSYRQGLWKF
DTECYKKYGKMWRTQDGQLPVLTITDPEMIKTVLVKECYSVFTNRRPLGPVGLMKSAISI
AEDEEWKRIRSLLSPTFTSGKLKEMFPIIAQYGDMLVRNLRREAEKGKPVTLKDIFGAYS
MDVITSTSFGVNIDSLNNPKDPFVESVKKFLKFDFLDPLFLLTILFPFLTPAFEALNVSL
FPKDAINFLNKSVNSMKKSRLNDKQKHRVDFLQLMIDSQNSKETESHKALSDQELVAQSI
IFIFAGYETTSSVLSFIIYELATHPDVQQKLQKEIDAVLPNKAPATYDAMVQMEYLDMVV
NETLRLFPIAIRLERACKKDVEINGVFIPKGAMVVIPTYALHHDPKYWTEPEEFRPERFS
KKNKDSIDPYIYTPFGTGPRNCIGMRFALMNMKLAIIKVLQNFSFKPCKETQIPLKLGNQ
GLLQSEKPIVLKVESRDGTLSGE
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggacctcatcccaaatttggccatggaaacctggcttctcctggctgtcagcctggtg
ctcctctatctatacgggacccgttcatatggactttttaagagacaaggaattccaggg
cccacacctctgccttttttgggaaatattttgtcctatcgtcagggtctctggaaattt
gacacagaatgttataaaaagtatgggaaaatgtggagaacgcaagatggtcaactccct
gtgctgaccatcacagatcccgagatgatcaaaacagtgctagtgaaagaatgttattct
gtcttcacaaatcgaaggcctttaggtccagtgggacttatgaaaagtgccatctctata
gctgaggatgaagaatggaagagaatacggtcattgctctctccaaccttcaccagcgga
aaactcaaggagatgttccccatcattgcccagtatggagatatgttggtgagaaacttg
aggcgggaagcagagaaaggcaagcctgtcaccctgaaagacatctttggggcctacagc
atggatgtgatcactagcacatcatttggagtaaacatcgactctctcaacaatccaaaa
gacccctttgtggaaagcgttaagaagttcctaaaatttgatttcttagatccattattt
ctcttaacaatactctttccattccttaccccagcttttgaggcattaaatgtctctctg
tttccaaaagatgccataaattttttaaataaatctgtaaacagcatgaaaaaaagtcgc
ctcaacgacaaacaaaagcaccgagtggatttccttcagctgatgattgactctcagaat
tcaaaagaaactgagtcccacaaagctctgtctgatcaggagctcgtggcccaatcaatt
atcttcatttttgctggctatgaaaccaccagcagtgttctttccttcattatatatgaa
ctggccactcaccctgatgtccagcagaaactgcagaaggagattgatgcagttttgccc
aataaggcacctgccacttatgatgccatggtacagatggagtaccttgacatggtggtg
aatgaaacactcagattattcccaattgctattagacttgagagggcctgcaagaaagat
gttgaaatcaatggggtgttcattcccaaaggggcaatggtggtgattccaacctatgct
cttcaccatgacccaaagtactggacagagcctgaggagttccgccctgaaaggttcagt
aagaagaacaaggacagcatagatccttacatatacacaccctttggaactggacccaga
aactgcattggcatgaggtttgctctcatgaacatgaaacttgctataatcaaagtcctt
cagaacttctccttcaaaccttgtaaagaaacacagatccccttgaaattaggcaaccaa
ggccttcttcaatcagaaaaacccattgttctaaaggttgagtcaagagatggaacccta
agtggagaatga

DBGET integrated database retrieval system