KEGG   Macaca mulatta (rhesus monkey): 678693Help
Entry
678693            CDS       T01028                                 

Gene name
CYP17A1
Definition
cytochrome P450c17 (EC:1.14.99.9 4.1.2.30)
Orthology
K00512  
steroid 17alpha-monooxygenase / 17alpha-hydroxyprogesterone aldolase [EC:1.14.99.9 4.1.2.30]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Ovarian steroidogenesis
Prolactin signaling pathway
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    678693 (CYP17A1)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    678693 (CYP17A1)
   04917 Prolactin signaling pathway
    678693 (CYP17A1)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.9  steroid 17alpha-monooxygenase
     678693 (CYP17A1)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.30  17alpha-hydroxyprogesterone aldolase
     678693 (CYP17A1)
Cytochrome P450 [BR:mcc00199]
 Cytochrome P450, animal type
  CYP17 family
   678693 (CYP17A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 508 aa AA seqDB search
MWELVALLLLTLAYLFWPKRRCPGAKYPKSLLSLPLVGSLPFLPRHGHMHNNFFKLQKKY
GPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQVTTLDILSNNRKGIAFADYGAH
WQLHRRLAMATFALFKDGDQKLEKIICQEISTLCDMLATHNGQTIDISFPVFVAITNVIS
LICFNISYKNGDPELKIVHNYNEGIIDSLGKESLVDLFPWLKVFPNKTLEKLKRHVKTRN
DLLTKIFENYKEKFHSDSITNMLDVLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIF
GAGVETTTSVVKWIVAFLLHNPQVKKKLYEEIDQNVGFSRTPTISDRNRLLLLEATIREV
LRIRPVAPMLIPHKANVDSSIGEFAVDKGTHVIINLWALHHNEKEWHQPDQFMPERFLNP
AGTQLISPSLSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLPSLEGNP
KVVFLIDSFKVKIKVRQAWREAQAEGST
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgtgggagcttgtggctctcttgctgctcaccctagcctatttattttggcccaagaga
aggtgccctggtgccaagtatcctaagagcctcctgtccctgcccctggtgggcagcctg
ccattcctccccagacatggccatatgcataacaactttttcaagctgcagaaaaaatat
ggccccatctattccgttcgtatgggcaccaagactacagtgattgttggccaccaccag
ctggccaaggaggtgcttattaagaagggcaaggacttctctgggcggcctcaagtgaca
actctagacatcctgtccaacaatcgtaagggtattgccttcgctgactacggcgcacat
tggcagctgcatcgaaggctggcgatggccacctttgccctgttcaaggatggcgatcag
aagctggagaagatcatttgtcaggaaatcagtacattgtgtgatatgctggccacccac
aacggacagaccatagacatctcctttcctgtcttcgtggcgataaccaatgtcatctcc
ttgatctgcttcaacatctcctacaagaatggggaccctgagttgaagatcgtacataat
tacaatgaaggcatcatagacagcctgggcaaggagagcctggtggacctattcccctgg
ttgaaggttttccccaacaaaactctggaaaaattaaagaggcatgttaaaacacgaaat
gatctgctgactaaaatatttgaaaattacaaggagaaattccacagcgactctatcacc
aacatgctggacgtactgatgcaagccaagatgaattcagataatggcaacgctggccca
gatcaagactcagagctgctttcagataaccacattctcaccaccataggggacatcttt
ggggctggcgtggagaccaccacctctgtggtgaaatggatcgtggccttcctgctgcac
aatcctcaggtgaagaagaagctctacgaggagattgaccagaatgtgggtttcagccgc
acaccaaccatcagtgaccgtaaccgtctcctcctgctggaggccaccatccgagaggtg
cttcgcatcaggcccgtggcccctatgctcatcccccacaaggccaacgttgactccagc
atcggtgagtttgctgtggacaagggcacacacgttatcatcaatctgtgggcgctgcat
cacaatgagaaggagtggcaccagccggaccagttcatgcctgagcgtttcttgaatcca
gcggggacccagcttatctcaccatcattaagctacttgcccttcggagcaggacctcgc
tcctgtataggtgagatcctggcccgccaggagctcttcctcatcatggcctggctgctg
cagaggttcgacctggaggtaccagatgatgggcagctgccctccctggaaggcaaccca
aaggtggtctttctgatcgactctttcaaagtgaagatcaaggtgcgccaggcctggagg
gaagcccaggctgagggtagcacctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system