KEGG   Macaca mulatta (rhesus monkey): 678693Help
Entry
678693            CDS       T01028                                 

Gene name
CYP17A1
Definition
cytochrome P450c17 (EC:1.14.99.9 4.1.2.30)
Orthology
K00512  
steroid 17alpha-monooxygenase / 17alpha-hydroxyprogesterone aldolase [EC:1.14.99.9 4.1.2.30]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Ovarian steroidogenesis
Prolactin signaling pathway
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:mcc00140]
Organismal Systems; Endocrine system; Ovarian Steroidogenesis [PATH:mcc04913]
Organismal Systems; Endocrine system; Prolactin signaling pathway [PATH:mcc04917]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 508 aa AA seqDB search
MWELVALLLLTLAYLFWPKRRCPGAKYPKSLLSLPLVGSLPFLPRHGHMHNNFFKLQKKY
GPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQVTTLDILSNNRKGIAFADYGAH
WQLHRRLAMATFALFKDGDQKLEKIICQEISTLCDMLATHNGQTIDISFPVFVAITNVIS
LICFNISYKNGDPELKIVHNYNEGIIDSLGKESLVDLFPWLKVFPNKTLEKLKRHVKTRN
DLLTKIFENYKEKFHSDSITNMLDVLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIF
GAGVETTTSVVKWIVAFLLHNPQVKKKLYEEIDQNVGFSRTPTISDRNRLLLLEATIREV
LRIRPVAPMLIPHKANVDSSIGEFAVDKGTHVIINLWALHHNEKEWHQPDQFMPERFLNP
AGTQLISPSLSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLPSLEGNP
KVVFLIDSFKVKIKVRQAWREAQAEGST
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgtgggagcttgtggctctcttgctgctcaccctagcctatttattttggcccaagaga
aggtgccctggtgccaagtatcctaagagcctcctgtccctgcccctggtgggcagcctg
ccattcctccccagacatggccatatgcataacaactttttcaagctgcagaaaaaatat
ggccccatctattccgttcgtatgggcaccaagactacagtgattgttggccaccaccag
ctggccaaggaggtgcttattaagaagggcaaggacttctctgggcggcctcaagtgaca
actctagacatcctgtccaacaatcgtaagggtattgccttcgctgactacggcgcacat
tggcagctgcatcgaaggctggcgatggccacctttgccctgttcaaggatggcgatcag
aagctggagaagatcatttgtcaggaaatcagtacattgtgtgatatgctggccacccac
aacggacagaccatagacatctcctttcctgtcttcgtggcgataaccaatgtcatctcc
ttgatctgcttcaacatctcctacaagaatggggaccctgagttgaagatcgtacataat
tacaatgaaggcatcatagacagcctgggcaaggagagcctggtggacctattcccctgg
ttgaaggttttccccaacaaaactctggaaaaattaaagaggcatgttaaaacacgaaat
gatctgctgactaaaatatttgaaaattacaaggagaaattccacagcgactctatcacc
aacatgctggacgtactgatgcaagccaagatgaattcagataatggcaacgctggccca
gatcaagactcagagctgctttcagataaccacattctcaccaccataggggacatcttt
ggggctggcgtggagaccaccacctctgtggtgaaatggatcgtggccttcctgctgcac
aatcctcaggtgaagaagaagctctacgaggagattgaccagaatgtgggtttcagccgc
acaccaaccatcagtgaccgtaaccgtctcctcctgctggaggccaccatccgagaggtg
cttcgcatcaggcccgtggcccctatgctcatcccccacaaggccaacgttgactccagc
atcggtgagtttgctgtggacaagggcacacacgttatcatcaatctgtgggcgctgcat
cacaatgagaaggagtggcaccagccggaccagttcatgcctgagcgtttcttgaatcca
gcggggacccagcttatctcaccatcattaagctacttgcccttcggagcaggacctcgc
tcctgtataggtgagatcctggcccgccaggagctcttcctcatcatggcctggctgctg
cagaggttcgacctggaggtaccagatgatgggcagctgccctccctggaaggcaaccca
aaggtggtctttctgatcgactctttcaaagtgaagatcaaggtgcgccaggcctggagg
gaagcccaggctgagggtagcacctaa

DBGET integrated database retrieval system