KEGG   Macaca mulatta (rhesus monkey): 678693Help
Entry
678693            CDS       T01028                                 

Gene name
CYP17A1, CYP17
Definition
(RefSeq) cytochrome P450c17
  KO
K00512  
steroid 17alpha-monooxygenase / 17alpha-hydroxyprogesterone deacetylase [EC:1.14.14.19 1.14.14.32]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Ovarian steroidogenesis
Prolactin signaling pathway
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    678693 (CYP17A1)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    678693 (CYP17A1)
   04917 Prolactin signaling pathway
    678693 (CYP17A1)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.19  steroid 17alpha-monooxygenase
     678693 (CYP17A1)
    1.14.14.32  17alpha-hydroxyprogesterone deacetylase
     678693 (CYP17A1)
Cytochrome P450 [BR:mcc00199]
 Cytochrome P450, animal type
  CYP17 family
   678693 (CYP17A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 508 aa AA seqDB search
MWELVALLLLTLAYLFWPKRRCPGAKYPKSLLSLPLVGSLPFLPRHGHMHNNFFKLQKKY
GPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQVTTLDILSNNRKGIAFADYGAH
WQLHRRLAMATFALFKDGDQKLEKIICQEISTLCDMLATHNGQTIDISFPVFVAITNVIS
LICFNISYKNGDPELKIVHNYNEGIIDSLGKESLVDLFPWLKVFPNKTLEKLKRHVKTRN
DLLTKIFENYKEKFHSDSITNMLDVLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIF
GAGVETTTSVVKWIVAFLLHNPQVKKKLYEEIDQNVGFSRTPTISDRNRLLLLEATIREV
LRIRPVAPMLIPHKANVDSSIGEFAVDKGTHVIINLWALHHNEKEWHQPDQFMPERFLNP
AGTQLISPSLSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLPSLEGNP
KVVFLIDSFKVKIKVRQAWREAQAEGST
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgtgggagcttgtggctctcttgctgctcaccctagcctatttattttggcccaagaga
aggtgccctggtgccaagtatcctaagagcctcctgtccctgcccctggtgggcagcctg
ccattcctccccagacatggccatatgcataacaactttttcaagctgcagaaaaaatat
ggccccatctattccgttcgtatgggcaccaagactacagtgattgttggccaccaccag
ctggccaaggaggtgcttattaagaagggcaaggacttctctgggcggcctcaagtgaca
actctagacatcctgtccaacaatcgtaagggtattgccttcgctgactacggcgcacat
tggcagctgcatcgaaggctggcgatggccacctttgccctgttcaaggatggcgatcag
aagctggagaagatcatttgtcaggaaatcagtacattgtgtgatatgctggccacccac
aacggacagaccatagacatctcctttcctgtcttcgtggcgataaccaatgtcatctcc
ttgatctgcttcaacatctcctacaagaatggggaccctgagttgaagatcgtacataat
tacaatgaaggcatcatagacagcctgggcaaggagagcctggtggacctattcccctgg
ttgaaggttttccccaacaaaactctggaaaaattaaagaggcatgttaaaacacgaaat
gatctgctgactaaaatatttgaaaattacaaggagaaattccacagcgactctatcacc
aacatgctggacgtactgatgcaagccaagatgaattcagataatggcaacgctggccca
gatcaagactcagagctgctttcagataaccacattctcaccaccataggggacatcttt
ggggctggcgtggagaccaccacctctgtggtgaaatggatcgtggccttcctgctgcac
aatcctcaggtgaagaagaagctctacgaggagattgaccagaatgtgggtttcagccgc
acaccaaccatcagtgaccgtaaccgtctcctcctgctggaggccaccatccgagaggtg
cttcgcatcaggcccgtggcccctatgctcatcccccacaaggccaacgttgactccagc
atcggtgagtttgctgtggacaagggcacacacgttatcatcaatctgtgggcgctgcat
cacaatgagaaggagtggcaccagccggaccagttcatgcctgagcgtttcttgaatcca
gcggggacccagcttatctcaccatcattaagctacttgcccttcggagcaggacctcgc
tcctgtataggtgagatcctggcccgccaggagctcttcctcatcatggcctggctgctg
cagaggttcgacctggaggtaccagatgatgggcagctgccctccctggaaggcaaccca
aaggtggtctttctgatcgactctttcaaagtgaagatcaaggtgcgccaggcctggagg
gaagcccaggctgagggtagcacctaa

DBGET integrated database retrieval system