KEGG   Macaca mulatta (rhesus monkey): 678694Help
Entry
678694            CDS       T01028                                 

Gene name
CYP1A1
Definition
(RefSeq) cytochrome P450, family 1, subfamily A, polypeptide 1
  KO
K07408  cytochrome P450 family 1 subfamily A polypeptide 1 [EC:1.14.14.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00140  Steroid hormone biosynthesis
mcc00380  Tryptophan metabolism
mcc00830  Retinol metabolism
mcc00980  Metabolism of xenobiotics by cytochrome P450
mcc01100  Metabolic pathways
mcc04913  Ovarian steroidogenesis
mcc05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    678694 (CYP1A1)
  Amino acid metabolism
   00380 Tryptophan metabolism
    678694 (CYP1A1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    678694 (CYP1A1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    678694 (CYP1A1)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    678694 (CYP1A1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    678694 (CYP1A1)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     678694 (CYP1A1)
Cytochrome P450 [BR:mcc00199]
 Cytochrome P450, animal type
  CYP1 family
   678694 (CYP1A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 678694
NCBI-ProteinID: NP_001035328
Ensembl: ENSMMUG00000022481
UniProt: Q6GUR1
Position
7
AA seq 512 aa AA seqDB search
MLFRISMSATEFLLASLIFCLVFWVIRASRPRVPKGLKNPPGPWGWPLIGHILTLGKNPH
LALSRMSQRYGDVLQIRIGSTPVLVLSGLDTIRQALVQQGDDFKGRPNLYSFTLISNGQS
MSFGPDSGPVWAARRRLAQNGLKSFSIASDPASSSSCYLEEHVSKEAEVLISKLQEQMAG
PGHFNPYRYVVISVANVICAICFGQRYDHNHQELLSLVNLSNNFGEVVGSGNPADFIPIL
RYLPNRSLNGFKDLNEKFHSFMQKMIKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANI
QLSDEKIVNVVLDLFGAGFDTVTTAISWSLMYLVTNPRVQRKIQEELDTVIGRSRRPRLS
DRSHLPYMEAFILETFRHSSFVPFTIPHSTTRDTSLKGFYIPKGRCVFVNQWQINHDQKL
WVNPSEFLPERFITPDGAIDKVLSEKVILFGLGKRKCIGETIARWEVFLFLAILLQRVEF
SVPPGVKVDMTPIYGLTMKHACCEHFQMQLRS
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgcttttccgaatctccatgtcggccacggagtttcttctagcctctctcatcttctgt
ctagtattctgggtaatcagggcctcaagacctcgggtccccaaaggcctgaagaatcca
ccagggccatggggctggcccctgatcgggcacatactaaccctgggaaagaacccacac
ctggcactgtcaaggatgagccagcggtatggggacgtgctgcagattcgcattggctcc
acacctgtgctggtgctgagcggcctggacaccatccggcaggccctggtgcagcagggc
gatgatttcaagggccggcccaacctctacagcttcaccctcatcagtaatggccagagc
atgtccttcggcccagactctggaccagtgtgggctgcccgccggcgcctggcccagaat
ggcctgaaaagtttctctattgcctctgacccagcctcctcatcttcctgctacctggag
gagcatgtgagcaaggaggctgaggtcctgatcagcaagttgcaggagcagatggcaggg
cctgggcactttaacccctacaggtatgtggtgatatcagtggccaatgtcatctgtgcc
atttgctttggccagcgctatgaccacaaccaccaagaactgcttagcctagtcaacctg
agtaataatttcggggaggtggttggctctggaaacccagctgacttcatccctattctt
cgctacctgcccaaccgttcccttaatggcttcaaggacttgaatgagaagttccacagc
ttcatgcagaagatgatcaaggagcactacaaaacctttgagaagggccacatccgggac
atcacagacagcctgattgagcactgtcaggagaagcagctggatgagaacgctaatatc
caactgtcagatgagaaaatcgttaatgtcgtcttggacctctttggagctgggtttgac
acagtcacaactgctatctcctggagcctcatgtatttggtgacgaaccccagggtacag
agaaagatccaagaagagctagacacagtgattggcaggtcacggcgcccccggctctct
gacagatcccatctcccctatatggaggcctttatcctggagaccttccgacactcctcc
ttcgtccccttcaccatcccccacagcaccacaagagacacaagtctgaaagggttttac
atccccaaggggcgttgtgtctttgtgaaccagtggcagatcaaccatgaccagaagcta
tgggtcaacccatctgagttcctacctgaacggtttatcacccctgatggtgctatcgac
aaggtgctaagtgagaaggtgattctctttggcttgggcaagcggaagtgcatcggtgag
accattgcccgctgggaagtctttctcttcctggccatcctgctgcagcgggtggagttc
agcgtgccaccgggtgtgaaggtggacatgacccccatctatgggctgaccatgaagcac
gcctgctgtgagcacttccaaatgcagctgcgctcttag

DBGET integrated database retrieval system