KEGG   Macaca mulatta (rhesus monkey): 678696Help
Entry
678696            CDS       T01028                                 

Gene name
CYP2F1, CYP2F6
Definition
cytochrome P450, family 2, subfamily F, polypeptide 6
Orthology
K07416  
cytochrome P450, family 2, subfamily F [EC:1.14.14.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Metabolism of xenobiotics by cytochrome P450
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    678696 (CYP2F1)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     678696 (CYP2F1)
Cytochrome P450 [BR:mcc00199]
 Cytochrome P450, animal type
  CYP2 family
   678696 (CYP2F1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
19
AA seq 491 aa AA seqDB search
MDSISTAILLLLLALVCLLLTLSSRDKXKLPPGPRPLPLLGNLLLLRSQNMLTSLTQLSK
EYGSVYTVHLGPRRVVVLSGYQAVKEALVDQGEEFSGRGDYPVFFNFTKGNGIAFSNGDR
WKVLRRFSIQILRNFGMGKRSIEERILEEGSFLLAELRKTEGEPFDPTFVLSRSVSNIIC
SVLFGSRFDYDDERLLTVIRLINDNFQIMSSPWGELYNIFPSLLDWVPGPHQRIFQNFKR
LRDLIAHXVHDQQASLDPRSPRDFIDCFLTKMAEEKEDPLSHFHMDTLLMTTHNLLFGGT
ETVGTTLRHAFLALMKYPKVQARVQEEIDLVVGRTRLPTLEDRAAMPYTDAVIHEVQRFA
DIIPMNLPHRVIRDTAFRXFLIPKGTDIITLLNTVHYDPSQFLXPQEFNPEHFLDANQSF
KKSPAFMPFSAGRRLCLGESLARMELFLYLTAILQSFSLQPLGAPEDIXLTPLSSGLGNL
PRXFQLCLCPR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggacagcataagcacagccatcttactcctgctcctggctctcgtctgtctgctcctg
accctaagctcaagagataagygaaagctgcctccaggacctagacccctcccactcctg
ggaaacctgctgctgcttcgctcccaaaacatgctgacttctctcactcagctgagcaag
gagtatggctctgtgtacacagtgcacctggggcccaggcgggtggtggtcctcagcggg
taccaagccgtgaaggaggccctggtggaccagggagaggagtttagtggccgcggtgac
taccctgtctttttcaactttaccaagggcaatggcatcgccttctccaatggggatcga
tggaaggtgctgagacggttctctatccagattctacggaatttcgggatggggaagaga
agcatcgaggagcggatcctagaggagggcagcttcctgctggcagagctgcggaaaact
gaaggcgagccctttgaccccacgtttgtgctgagtcgctcagtgtccaacattatctgt
tccgtgctcttcggcagccgcttcgactacgatgatgagcgtctgctcaccgttatccgc
cttatcaatgacaacttccaaatcatgagcagcccctggggcgagttgtacaacatcttc
ccgagcctcctggactgggtgcccgggccgcaccaacgcatcttccagaacttcaagcgc
ctgagagacctcatcgcccacagmgtccacgaccagcaggcctctctagaccccagatct
ccccgggacttcatcgactgcttcctcaccaagatggcagaggagaaggaggacccactg
agccacttccacatggataccctgctgatgaccacacataacctgctctttggcggcacc
gagacggtgggcaccacgctgcgccacgccttcctggcactcatgaagtacccgaaagtt
caagcccgcgtgcaggaggagatcgacctcgtggtgggacgcacgcggttgccgacgctg
gaggaccgcgcggccatgccttacacagatgctgtgatccacgaggtgcagcgctttgca
gacatcatccccatgaacttgccgcaccgcgtcattcgggacacggcctttcgcrgcttc
ctgatacccaagggcaccgatatcatcaccctccttaacaccgtccactacgaccccagc
cagttcctgaygccccaggagttcaaccctgagcattttttggatgccaatcagtccttc
aagaagagcccagcctttatgcccttctcagctgggcgccgtctgtgcctgggcgagtcg
ctggcgcgcatggagctctttctgtacctcaccgccatcctscagagcttctcgctgcag
ccgctgggtgcgcccgaggacatckacctgaccccgctcagctcaggtctsggcaatttg
ccgcggyctttccagctgtgyctgtgcccgcgctaa

DBGET integrated database retrieval system