KEGG   Macaca mulatta (rhesus monkey): 693322Help
Entry
693322            CDS       T01028                                 

Gene name
GALC
Definition
galactosylceramidase (EC:3.2.1.46)
Orthology
K01202  
galactosylceramidase [EC:3.2.1.46]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    693322 (GALC)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    693322 (GALC)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     693322 (GALC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 669 aa AA seqDB search
MTAAAGSAGRAAVPFLLCALLAPGGAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPE
PYRSQILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYALDENYFRGYEWWLMKE
AKKRNPNITLIGLPWSFPGWLGKGFDWPYVNLQLTAYYVVTWIVGAKRYHDLDIDYIGIW
NERSYNANYIKILRKMLNSQGLQRVKIIASDNLWESISAAMLLDAELFKVVDVIGAHYPG
THSVKDARLTGKKLWSSEDFSTLNSDTGAGCWGRILNQNYVNGYMTSTIAWNLVASYYEQ
LPYGRCGLMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDG
LGNLTIIIETMSHKHSKCIRPFLPYFNVSQQFATFVLKGSFSEIPELQVWYTKLGKTSER
FLFKQLDSLWLLDSNGSFTLKLQEDELFTLTTLTTGRKGSYLPPPKSQRFPSTYKDDFNV
DYPFFSEAPNFADQTGVFEYFTNMEDPGEHHFTLRQVLNQRPITWAADASNTISIIGDYN
WTNLTIKCDVYIETPDTGGVFIAGRVNKGGILIRSARGIFFWIFANGSYRVTGDLAGWII
YALGHVEVTAKTWYTLTLTIKGRFASGMLNDKSLWTDIPVNFPKNGWAAIGTHSFEFAQF
DNFHVEATR
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgacggccgccgcgggttcggcgggccgcgccgcggtgcccttcctgctgtgtgcgctg
ctggcgcccggcggcgcgtacgtgctcgacgactccgacgggctgggccgggagttcgac
ggcatcggcgcggtcagcggcggcggggcaacctcccgacttctagtaaattacccagag
ccctatcgttctcagatattggattatctctttaagccgaattttggtgcctctttgcat
attctaaaagtggaaataggtggtgatgggcagacaacagatggcactgagccctcccac
atgcactatgcactagatgagaattattttcgaggatatgagtggtggttaatgaaggaa
gctaagaagaggaatcccaatattacactcattgggttgccatggtcattccctggatgg
ctgggaaaaggttttgactggccttatgtcaatcttcagctgactgcctattatgtcgtg
acctggattgtgggtgccaagcgttatcatgatttggacattgattatattggaatttgg
aatgagaggtcatataatgccaattacattaagatattaagaaaaatgctgaactctcaa
ggtctccagcgagtgaaaatcatagcaagtgataatctctgggagtccatctctgcagcc
atgctacttgatgctgaactcttcaaggtggttgatgttataggggctcattatcctgga
acccattcagtaaaagatgcaaggttgactgggaagaagctttggtcttctgaagacttt
agcactttaaatagtgacacgggtgcaggctgctggggtcgcattttaaatcagaattat
gtcaatggctatatgacttccacaatcgcatggaatttagtggctagttactatgaacag
ttgccttatgggagatgcgggttgatgacagcccaggagccatggagtggtcactacgtg
gtagaatctcctgtctgggtgtcagctcataccactcagtttactcaacctggctggtat
tacctgaagacagttggccatttagagaaaggaggaagctatgtagctctgactgatggc
ttagggaacctcaccatcatcattgaaaccatgagtcataaacattctaagtgcatacgg
ccatttcttccttatttcaatgtgtcacaacaatttgctacctttgttcttaagggatct
tttagtgaaataccagagctacaggtgtggtataccaaacttggaaaaacatctgaaaga
tttctttttaagcagctggattctctatggctcctcgacagcaatggcagtttcacactg
aaactgcaagaagatgagctgttcacactcaccactctcaccactggtcgcaaaggcagc
tacctgcctcctccaaaatcccagcgcttcccaagtacctataaggatgatttcaatgtt
gattacccattttttagtgaagctccaaactttgctgatcaaactggtgtatttgaatat
tttacaaatatggaagaccctggtgagcatcacttcacgctacgccaagttctcaaccag
agacccattacgtgggctgccgatgcatccaacacaatcagtattataggagactacaac
tggacgaatctgactataaaatgtgatgtttacatagagacccctgacacaggaggtgtg
ttcattgcaggaagagtaaataaaggtggtattttgattagaagtgccagaggaattttc
ttctggatttttgcaaatggatcttacagggttacaggggatttagctggatggattata
tatgctttaggacatgttgaagttacagcaaaaacatggtatacactcacattaactatt
aagggtcgttttgcctctggcatgctgaatgacaagtctctgtggacagacatccctgtg
aattttccgaagaatggctgggctgcaattggaactcactcctttgaatttgcacagttt
gacaactttcatgtggaagccacacgctaa

DBGET integrated database retrieval system