KEGG   Macaca mulatta (rhesus monkey): 693507Help
Entry
693507            CDS       T01028                                 

Definition
histone H2B type 1-F/J/L-like
Orthology
K11252  
histone H2B
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:mcc05203]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:mcc05322]
Human Diseases; Substance dependence; Alcoholism [PATH:mcc05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 126 aa AA seqDB search
MPEPSRAAPAPKKGSKKAITKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgccggagccatcgcgggcggctccggctcctaaaaagggctccaagaaggccatcacc
aaggcgcagaagaaggacggcaagaagcgcaaacgcggccgcaaggagagctattctatc
tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaatgatatcttcgagcgcatcgccagcgaggcctcccgc
ctggcgcactacaacaagcgctccaccatcacgtcccgcgaagtgcagacggccgtgcgc
ctgctgctgccgggcgagctggccaagcacgccgtgtccgagggcaccaaggctgtcacc
aagtacaccagctccaagtga

DBGET integrated database retrieval system