KEGG   Macaca mulatta (rhesus monkey): 693520Help
Entry
693520            CDS       T01028                                 

Gene name
GLS
Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    693520 (GLS)
   00330 Arginine and proline metabolism
    693520 (GLS)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    693520 (GLS)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    693520 (GLS)
  Nervous system
   04724 Glutamatergic synapse
    693520 (GLS)
   04727 GABAergic synapse
    693520 (GLS)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    693520 (GLS)
   05206 MicroRNAs in cancer
    693520 (GLS)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     693520 (GLS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 609 aa AA seqDB search
MREPRAPTAADGPGGMMRLRGSAMLRDLLLRSPAGVSATLRRAQPLVTLCRRPRSGGRPA
AGPAAAARLHPWWGGGGWPAGPLVRGLSSSPSEILQELGKGSTHPQPGVSPPAAPAAPGP
KDSPGETDAFGNSEGKELVASGENKIKQGLLPSLEDLLFYTIAEGQEKIPVHKFITALKS
TGLRTSDPRLKECMDMLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFM
SFTSHIDELYESAKKQSGGKVNLHEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYVMQ
FLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSI
EVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPA
KSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAKKL
DPRREGGDQRVKSVINLLFAAYTGDVSALRRFALSAMDMEQRDYDSRTALHVAAAEGHVE
VVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT
VHKNLDGLL
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgcgagaacccagagcccctacggccgctgacggacccggcggtatgatgcggctgcga
ggctcggcgatgctgcgggacctgctcctgcggtcgccagccggcgtgagcgcgactctg
cggcgggcacagcccctggtcaccctgtgccggcgtccccgaagcgggggacggccggcc
gcgggcccagctgccgccgcgcgactccacccgtggtggggcgggggcggctggccggcg
gggccccttgtgcggggcctgtccagctctccctcggagatcttgcaggagctgggcaag
gggagcacgcatccgcagcccggggtgtcgccacccgctgccccggcggcgcccggcccc
aaggacagccccggggagacggacgcgtttggcaacagcgagggcaaagagctggtggcc
tcaggtgaaaataaaataaaacagggtctgttacctagcttggaagatttgctgttctat
acaattgcggaaggacaagagaaaatacccgttcataaatttattacagcactcaaatct
acaggattgcgaacgtctgatcccaggttgaaagagtgtatggatatgttaagattaact
cttcaaacaacatcagatggtgtcatgctagacaaagatctttttaaaaaatgtgttcag
agcaacattgttttgttgacacaagcctttagaagaaagtttgtcattcctgactttatg
tcttttacctcacacattgatgagttatatgaaagtgctaaaaagcagtctggaggaaag
gttaatttacatgaggatgacaaaccacataatcctatggtaaatgctggagcaattgtt
gtgacttcactaataaagcaaggagtaaataatgctgaaaaatttgactatgtcatgcag
tttttgaataagatggctggtaatgaatatgttggattcagtaatgcgacgtttcagtct
gaaagagaaagtggagatcgaaattttgcaataggatattacttaaaagaaaagaagtgt
tttccagaaggcacagatatggttggtatattagacttctacttccagctgtgctccatt
gaagtgacttgtgaatcagccagtgtgatggctgcgacactggctaatggtggtttctgc
ccaattactggtgaaagagtactgagccctgaagcagttcgaaatactttgagtttgatg
cattcctgtggcatgtatgacttctcagggcagtttgcttttcatgttggtcttcctgca
aaatctggagttgctgggggcattcttttagttgtccccaatgttatgggtatgatgtgc
tggtctcctcctctggataagatgggcaacagtgttaagggaattcacttttgtcacgat
cttgtttctctgtgtaatttccataactatgataatttgagacactttgcaaaaaaactt
gatcctcgaagagaaggtggtgatcaaagggtaaagtcagtgataaatcttttgtttgct
gcatatactggagatgtgtctgcacttcgaagatttgctttgtcagctatggacatggaa
cagcgggactatgattctagaacagcactgcatgtagctgctgcagagggtcatgttgaa
gttgttaaatttttgctggaagcctgcaaagtaaaccctttccccaaggacaggtggaat
aacactcccatggatgaagcactgcactttggacaccatgatgtatttaaaattctccaa
gaataccaagtccagtacacacctcaaggagattctgacaacgggaaggaaaatcaaacc
gtccataagaatcttgatggattgttgtaa

DBGET integrated database retrieval system