KEGG   Macaca mulatta (rhesus monkey): 693520Help
Entry
693520            CDS       T01028                                 

Gene name
GLS
Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mcc00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mcc00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:mcc00471]
Organismal Systems; Excretory system; Proximal tubule bicarbonate reclamation [PATH:mcc04964]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:mcc04724]
Organismal Systems; Nervous system; GABAergic synapse [PATH:mcc04727]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:mcc05206]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 609 aa AA seqDB search
MREPRAPTAADGPGGMMRLRGSAMLRDLLLRSPAGVSATLRRAQPLVTLCRRPRSGGRPA
AGPAAAARLHPWWGGGGWPAGPLVRGLSSSPSEILQELGKGSTHPQPGVSPPAAPAAPGP
KDSPGETDAFGNSEGKELVASGENKIKQGLLPSLEDLLFYTIAEGQEKIPVHKFITALKS
TGLRTSDPRLKECMDMLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFM
SFTSHIDELYESAKKQSGGKVNLHEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYVMQ
FLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSI
EVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPA
KSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAKKL
DPRREGGDQRVKSVINLLFAAYTGDVSALRRFALSAMDMEQRDYDSRTALHVAAAEGHVE
VVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT
VHKNLDGLL
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgcgagaacccagagcccctacggccgctgacggacccggcggtatgatgcggctgcga
ggctcggcgatgctgcgggacctgctcctgcggtcgccagccggcgtgagcgcgactctg
cggcgggcacagcccctggtcaccctgtgccggcgtccccgaagcgggggacggccggcc
gcgggcccagctgccgccgcgcgactccacccgtggtggggcgggggcggctggccggcg
gggccccttgtgcggggcctgtccagctctccctcggagatcttgcaggagctgggcaag
gggagcacgcatccgcagcccggggtgtcgccacccgctgccccggcggcgcccggcccc
aaggacagccccggggagacggacgcgtttggcaacagcgagggcaaagagctggtggcc
tcaggtgaaaataaaataaaacagggtctgttacctagcttggaagatttgctgttctat
acaattgcggaaggacaagagaaaatacccgttcataaatttattacagcactcaaatct
acaggattgcgaacgtctgatcccaggttgaaagagtgtatggatatgttaagattaact
cttcaaacaacatcagatggtgtcatgctagacaaagatctttttaaaaaatgtgttcag
agcaacattgttttgttgacacaagcctttagaagaaagtttgtcattcctgactttatg
tcttttacctcacacattgatgagttatatgaaagtgctaaaaagcagtctggaggaaag
gttaatttacatgaggatgacaaaccacataatcctatggtaaatgctggagcaattgtt
gtgacttcactaataaagcaaggagtaaataatgctgaaaaatttgactatgtcatgcag
tttttgaataagatggctggtaatgaatatgttggattcagtaatgcgacgtttcagtct
gaaagagaaagtggagatcgaaattttgcaataggatattacttaaaagaaaagaagtgt
tttccagaaggcacagatatggttggtatattagacttctacttccagctgtgctccatt
gaagtgacttgtgaatcagccagtgtgatggctgcgacactggctaatggtggtttctgc
ccaattactggtgaaagagtactgagccctgaagcagttcgaaatactttgagtttgatg
cattcctgtggcatgtatgacttctcagggcagtttgcttttcatgttggtcttcctgca
aaatctggagttgctgggggcattcttttagttgtccccaatgttatgggtatgatgtgc
tggtctcctcctctggataagatgggcaacagtgttaagggaattcacttttgtcacgat
cttgtttctctgtgtaatttccataactatgataatttgagacactttgcaaaaaaactt
gatcctcgaagagaaggtggtgatcaaagggtaaagtcagtgataaatcttttgtttgct
gcatatactggagatgtgtctgcacttcgaagatttgctttgtcagctatggacatggaa
cagcgggactatgattctagaacagcactgcatgtagctgctgcagagggtcatgttgaa
gttgttaaatttttgctggaagcctgcaaagtaaaccctttccccaaggacaggtggaat
aacactcccatggatgaagcactgcactttggacaccatgatgtatttaaaattctccaa
gaataccaagtccagtacacacctcaaggagattctgacaacgggaaggaaaatcaaacc
gtccataagaatcttgatggattgttgtaa

DBGET integrated database retrieval system