KEGG   Macaca mulatta (rhesus monkey): 693812Help
Entry
693812            CDS       T01028                                 

Gene name
DYRK1A
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 763 aa AA seqDB search
MHTGGETSACKPSSVRLAPSFSFHAAGLQMAGQMPHSHPYSDRRQPSISDQQVSALAYSD
QIQQPLTNQVMPDIVMLQRRMPQTFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRHQ
QGQGDDSSHKKERKVYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRV
EQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYYIVHLKRHFMFRNHLCLVFEM
LSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKR
SAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPL
FSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKLPDGTWNLKKTKDGKREYKPPGT
RKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFK
KTADEGTNTSNSVSTSPAMEQSQSSGTTSSTSSSSGGSSGTSNSGRARSDPTHQHRHSGG
HFTAAVQAMDCETHSPQVRQQFPAPLGWSGTEAPTQVTVETHPVQETTFHVAPQQNALHH
HHGNSSHHHHHHHHHHHHHGQQALGNRTRPRVYNSPTNSSSTQDSMEVGHSHHSMTSLSS
STTSSSTSSSSTGNQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTY
QFSANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVASS
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaggaggagagacttcagcatgcaaaccttcatctgttcggcttgcaccgtca
ttttcattccatgctgctggccttcagatggctggacagatgccccattcacacccgtac
agtgaccgtcgccagccaagcataagtgaccagcaggtttctgccttagcgtattctgac
cagattcagcaacctctaaccaaccaggtgatgcctgatattgtcatgttacagaggcgg
atgccccaaaccttccgtgacccagcaactgctcccctgagaaaactttctgttgacttg
atcaaaacatacaagcatattaatgaggtttactatgcaaaaaagaagcgaagacaccaa
cagggccagggagacgattctagtcataagaaggaacggaaggtttacaatgatggttat
gatgatgataactatgattatattgtaaaaaacggagaaaagtggatggatcgttacgaa
atcgactccttgataggcaaaggttcctttggacaggttgtaaaggcatatgatcgtgtg
gagcaagaatgggttgccattaaaataataaagaacaagaaggcttttctgaatcaagca
cagatagaagtgcgacttcttgagctcatgaacaaacatgacactgaaatgaaatactac
atagtgcatttgaaacgtcactttatgtttcggaaccatctctgtttagtttttgaaatg
ctctcctacaacctctatgacttgctgagaaacaccaatttccgaggggtctctttgaac
ctcacacgaaagtttgcacaacagatgtgcactgcactgcttttccttgcgactccagaa
cttagtatcattcactgtgatctaaaacctgaaaatatccttctttgtaaccccaaacgc
agtgcaatcaagatcgttgactttggcagttcttgtcagttggggcagaggatataccag
tatattcagagtcgcttttatcggtctccagaggtgctactgggaatgccttatgacctt
gccattgatatgtggtccctcgggtgtattttggttgaaatgcacactggagaacctctg
ttcagtggtgccaatgaggtagatcagatgaataaaatagtggaagttctgggtattcca
cctgctcatattcttgaccaagcaccaaaagcaagaaagttctttgagaagttgccagat
ggcacttggaacttaaagaagaccaaagatggaaaacgggagtacaaaccaccaggaacc
cgtaaacttcataacattcttggagtggaaacaggaggacctggtgggcgacgtgctggg
gagtcaggtcatacggtcgctgactacttgaagttcaaagacctcattttaaggatgctt
gattatgaccccaaaactcgaattcaaccttattatgctctgcagcacagtttcttcaag
aaaacagctgatgaaggtacaaatacaagtaatagtgtgtctacaagccccgccatggag
cagtctcagtcttcgggcaccacctccagtacatcatcaagctcaggtggctcatcgggg
acaagcaacagtgggagagcccggtcggatccgacgcaccagcatcggcacagtggcggg
cacttcacagctgccgtgcaggccatggactgcgagacacacagtccccaggtgcgtcag
caatttcctgctcctcttggttggtcaggcactgaagctcctacacaggtcactgttgaa
actcatcctgttcaagaaacaacctttcatgtagcccctcaacagaatgcattgcatcat
caccatggtaacagttcccatcaccatcaccaccaccaccaccatcaccaccaccatgga
caacaagccttgggtaaccggaccaggccaagggtctacaattctccaacgaatagctcc
tctacccaagattctatggaggttggccacagtcaccactccatgacatccctgtcttcc
tcaacgacttcttcctcgacatcttcctcctctactggtaatcaaggcaatcaggcctac
cagaatcgcccagtggctgctaataccttggactttggacagaatggagctatggacgtt
aatttgaccgtctactccaatccccgccaagagactggcatagctggacatccaacttac
caattttctgctaatacaggtcctgcacattacatgactgaaggacatctgacaatgagg
caaggggctgatagagaagagtcccccatgacaggagtttgtgtgcaacagagtcctgta
gctagctcgtga

DBGET integrated database retrieval system