KEGG   Macaca mulatta (rhesus monkey): 693914Help
Entry
693914            CDS       T01028                                 

Gene name
MAP2K6
Definition
(RefSeq) mitogen-activated protein kinase kinase 6
  KO
K04433  mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04015  Rap1 signaling pathway
mcc04218  Cellular senescence
mcc04380  Osteoclast differentiation
mcc04620  Toll-like receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04668  TNF signaling pathway
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04912  GnRH signaling pathway
mcc05014  Amyotrophic lateral sclerosis (ALS)
mcc05145  Toxoplasmosis
mcc05164  Influenza A
mcc05167  Kaposi's sarcoma-associated herpesvirus infection
mcc05169  Epstein-Barr virus infection
mcc05418  Fluid shear stress and atherosclerosis
Module
mcc_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    693914 (MAP2K6)
   04010 MAPK signaling pathway
    693914 (MAP2K6)
   04668 TNF signaling pathway
    693914 (MAP2K6)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    693914 (MAP2K6)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    693914 (MAP2K6)
   04664 Fc epsilon RI signaling pathway
    693914 (MAP2K6)
  Endocrine system
   04912 GnRH signaling pathway
    693914 (MAP2K6)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    693914 (MAP2K6)
  Development
   04380 Osteoclast differentiation
    693914 (MAP2K6)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    693914 (MAP2K6)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    693914 (MAP2K6)
  Infectious diseases
   05164 Influenza A
    693914 (MAP2K6)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    693914 (MAP2K6)
   05169 Epstein-Barr virus infection
    693914 (MAP2K6)
   05145 Toxoplasmosis
    693914 (MAP2K6)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     693914 (MAP2K6)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: STE group
  STE7 family
   693914 (MAP2K6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Seadorna_VP7 DUF4344 Choline_kinase APH
Motif
Other DBs
NCBI-GeneID: 693914
NCBI-ProteinID: NP_001248635
Ensembl: ENSMMUG00000001051
UniProt: H9EP89
Position
11
AA seq 334 aa AA seqDB search
MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELG
RGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALF
REGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDV
KPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDI
WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSK
ERPTYPELMQHPFFTLHESKGTDVASFVKLILGD
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagtcgaaaggcaagaagcgaaaccctggccttaaaattccaaaagaagcattt
gagcaacctcagaccagttccacaccacctcgagatttagactccaaggcttgcatttct
attggaaatcagaactttgaggtgaaggcagatgacctagagcctataatggaactggga
cgaggtgcgtacggggtggtggagaagatgcggcacgtgcccagcgggcagatcatggca
gtgaagcggattcgagccacagtaaatagccaggaacagaaaaggctactgatggatttg
gatatttccatgaggacggtggactgtccattcaccgtcaccttttatggcgcactgttt
cgggagggtgatgtgtggatctgcatggagctcatggacacatcactagataaattctac
aaacaagttattgataaaggccagacaattccagaggacatcttagggaaaatagcagtt
tctattgtaaaagcattagaacatttacacagtaagctgtctgtcattcacagagacgtc
aagccttctaatgtactcattaatgctctcggtcaagtgaagatgtgcgattttggaatc
agtggctacttggtggactctgttgctaaaacaattgatgcgggttgcaaaccatacatg
gcccctgaaagaataaacccagagctcaaccagaagggatacagtgtgaagtctgacatt
tggagtctgggcatcacgatgattgagttggccatccttcgatttccctatgattcctgg
ggaactccatttcagcagctcaaacaggtggtagaggagccatctccacaactcccagca
gacaagttctctgcagagttcgttgactttacctcacagtgcttaaagaagaattccaaa
gaacggcctacatacccagagctaatgcaacatccatttttcaccctacatgaatccaaa
ggaacagatgtggcatcttttgtaaaactgattcttggagattaa

DBGET integrated database retrieval system