KEGG   Macaca mulatta (rhesus monkey): 694018Help
Entry
694018            CDS       T01028                                 

Gene name
USP22
Definition
ubiquitin carboxyl-terminal hydrolase 27-like
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
mcc  Macaca mulatta (rhesus monkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
X
AA seq 487 aa AA seqDB search
MKGVRAAIGAESWKRLKETARKRGLAAEAASTRGLRREDSRGRRLLPPPPPSVKVPFGSS
CHSHRAPSGRAGDTPASTSTEVSHQQCSVPGLGEKFPTWETTKPELELLGHNPRRRRITS
SFTIGLRGLINLGNTCFMNCIVQALTHTPILRDFFLSDRHRCEMPSPELCLVCEMSSLFR
ELYSGNPSPHVPYKLLHLVWIHARHLAGYRQQDAHEFLIAALDVLHRHCKGDDVGKAANN
PNHCNCIIDQIFTGGLQSDVTCQACHGVSTTIDPCWDISLDLPGSCTSFWPMSPGRESSV
NGESHIPGITTLTDCLRRFTRPEHLGSSAKIKCGSCQSYQESTKQLTMNKLPVVACFHFK
RFEHSAKQRRKITTYISFPLELDMTPFMASSKESRMNGQLQLPTNSGNNENKYSLFAVVN
HQGTLESGHYTSFIRHHKDQWFKCDDAVITKASIKDVLDSEGYLLFYHKQVLEHESEKVK
EMNTQAY
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaagggggtcagagcagcgattggagccgagagctggaagcgccttaaagagactgcg
cggaaacggggcctggctgcagaagcagcctccactagggggcttcggcgggaggattcc
cgggggcgtcgcctgcttccgccgccgcctccttcagtgaaagtcccttttgggtccagc
tgccacagccaccgcgctccctcaggccgggcgggggacaccccagcctccacctcaaca
gaggtttctcaccagcagtgttcagtgccaggccttggcgagaaattcccaacctgggaa
acaaccaaaccagaattagaactgctggggcacaacccgaggagaagaagaatcacgtcc
agctttacgatcggtttaagaggactcatcaatcttggcaacacgtgctttatgaactgc
atcgtccaggccctcacccacacgccaatactgagagatttctttctctctgacaggcac
cgatgtgagatgccgagtcccgagttgtgtctggtctgtgagatgtcgtcgctgtttcgg
gagttgtattctggaaacccgtctcctcatgtgccctataagttactgcacctggtgtgg
atacatgcccgccatttagcagggtacaggcaacaggatgcccacgagttcctcattgca
gcattagatgtcctgcacaggcactgcaaaggtgatgatgtcgggaaggcggccaacaat
cccaaccactgtaactgcatcatagaccaaatcttcacaggtggcctacagtctgatgtc
acctgtcaagcctgccatggcgtctccaccacgatagacccatgctgggacattagtttg
gacttgcctggctcttgtacctccttctggcccatgagcccagggagggagagcagtgtg
aatggggaaagccacataccaggaatcaccaccctcacggactgcttgcggaggtttacg
aggccagagcacttaggaagcagtgccaaaatcaaatgtggtagttgccaaagctaccag
gaatctaccaaacagctcacaatgaataaattacctgtcgttgcctgttttcatttcaaa
cggtttgaacattcagccaaacagaggcgcaagatcactacatacatttcctttcctctg
gagctggatatgacaccgtttatggcctcaagtaaagagagcagaatgaatggacaattg
cagctgccaaccaatagtggaaacaatgaaaataagtattccttgtttgctgtagttaat
caccaaggaaccttggagagtggccactataccagcttcatccggcaccacaaggaccag
tggttcaagtgtgatgatgccgtcatcactaaggccagtattaaggatgtactggacagt
gaagggtatttactgttctatcacaaacaggtgctggaacatgagtcagaaaaagtgaaa
gaaatgaacacacaagcctactga

DBGET integrated database retrieval system