KEGG   Macaca mulatta (rhesus monkey): 694224Help
Entry
694224            CDS       T01028                                 

Gene name
CCNH
Definition
cyclin H
Orthology
K06634  
cyclin H
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Basal transcription factors
Nucleotide excision repair
Cell cycle
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:mcc03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:mcc03420]
Cellular Processes; Cell growth and death; Cell cycle [PATH:mcc04110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 323 aa AA seqDB search
MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYY
EKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPM
LENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLRE
NRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDD
DYVSKKSKHEEEEWTDDDLVESL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtaccacaacagtagccagaagcggcactggactttctccagtgaggagcagctggca
agactgcgggccgacgccaaccgcaaattcagatgcaaagcggtggccaacgggaaggtt
cttccgaatgatccagtctttcttgagcctcatgaagaaatgacactctgcaaatactat
gagaaaaggttattggaattctgttcggtgtttaagccagcaatgccaaggtctgttgtg
ggtacagcttgtatgtatttcaaacgtttttatcttaataactcagtaatggaatatcac
cccaggataataatgctcacttgtgcatttttggcctgcaaagtagatgaattcaatgta
tctagtcctcagtttgttggaaaccttcgggagagtcctcttggacaggagaaggcactt
gaacagatactggaatatgaactacttcttatacagcaacttaatttccaccttattgtc
cacaatccttacagaccatttgagggcttcctcatcgacttaaagacccgctaccccatg
ttggagaatccagagattttgaggaaaacagctgatgactttcttaatagaattgcattg
acggatgcctaccttttatacacaccttcccaaattgccctgactgccattttatctagt
gcctccagggctggaattactatggaaagttatttatcagagagtctgatgctgagagag
aacagaacttgcctgtcacagttactagatataatgaaaagcatgagaaacttagtaaaa
aagtatgagccacccagatctgaagaagttgctgttctgaaacagaagttggagcgatgt
cattctgctgagcttgcacttaatgtaatcacgaagaagaggaaaggctatgaagatgat
gattacgtctcaaagaagtccaaacatgaggaggaagaatggactgacgacgacctggta
gaatctctctaa

DBGET integrated database retrieval system