KEGG   Macaca mulatta (rhesus monkey): 694224Help
Entry
694224            CDS       T01028                                 

Gene name
CCNH
Definition
(RefSeq) cyclin H
  KO
K06634  cyclin H
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc03022  Basal transcription factors
mcc03420  Nucleotide excision repair
mcc04110  Cell cycle
Module
mcc_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    694224 (CCNH)
  Replication and repair
   03420 Nucleotide excision repair
    694224 (CCNH)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    694224 (CCNH)
Transcription machinery [BR:mcc03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     694224 (CCNH)
DNA repair and recombination proteins [BR:mcc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     694224 (CCNH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_C_2 Cyclin_N Cyclin_C Helo_like_N
Motif
Other DBs
NCBI-GeneID: 694224
NCBI-ProteinID: NP_001253375
Ensembl: ENSMMUG00000003248
UniProt: G7MV81
Position
6
AA seq 323 aa AA seqDB search
MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYY
EKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPM
LENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLRE
NRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDD
DYVSKKSKHEEEEWTDDDLVESL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtaccacaacagtagccagaagcggcactggactttctccagtgaggagcagctggca
agactgcgggccgacgccaaccgcaaattcagatgcaaagcggtggccaacgggaaggtt
cttccgaatgatccagtctttcttgagcctcatgaagaaatgacactctgcaaatactat
gagaaaaggttattggaattctgttcggtgtttaagccagcaatgccaaggtctgttgtg
ggtacagcttgtatgtatttcaaacgtttttatcttaataactcagtaatggaatatcac
cccaggataataatgctcacttgtgcatttttggcctgcaaagtagatgaattcaatgta
tctagtcctcagtttgttggaaaccttcgggagagtcctcttggacaggagaaggcactt
gaacagatactggaatatgaactacttcttatacagcaacttaatttccaccttattgtc
cacaatccttacagaccatttgagggcttcctcatcgacttaaagacccgctaccccatg
ttggagaatccagagattttgaggaaaacagctgatgactttcttaatagaattgcattg
acggatgcctaccttttatacacaccttcccaaattgccctgactgccattttatctagt
gcctccagggctggaattactatggaaagttatttatcagagagtctgatgctgagagag
aacagaacttgcctgtcacagttactagatataatgaaaagcatgagaaacttagtaaaa
aagtatgagccacccagatctgaagaagttgctgttctgaaacagaagttggagcgatgt
cattctgctgagcttgcacttaatgtaatcacgaagaagaggaaaggctatgaagatgat
gattacgtctcaaagaagtccaaacatgaggaggaagaatggactgacgacgacctggta
gaatctctctaa

DBGET integrated database retrieval system