KEGG   Macaca mulatta (rhesus monkey): 694224Help
Entry
694224            CDS       T01028                                 

Gene name
CCNH
Definition
cyclin H
Orthology
K06634  
cyclin H
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Basal transcription factors
Nucleotide excision repair
Cell cycle
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    694224 (CCNH)
  Replication and repair
   03420 Nucleotide excision repair
    694224 (CCNH)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    694224 (CCNH)
Transcription machinery [BR:mcc03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     694224 (CCNH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 323 aa AA seqDB search
MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYY
EKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPM
LENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLRE
NRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDD
DYVSKKSKHEEEEWTDDDLVESL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtaccacaacagtagccagaagcggcactggactttctccagtgaggagcagctggca
agactgcgggccgacgccaaccgcaaattcagatgcaaagcggtggccaacgggaaggtt
cttccgaatgatccagtctttcttgagcctcatgaagaaatgacactctgcaaatactat
gagaaaaggttattggaattctgttcggtgtttaagccagcaatgccaaggtctgttgtg
ggtacagcttgtatgtatttcaaacgtttttatcttaataactcagtaatggaatatcac
cccaggataataatgctcacttgtgcatttttggcctgcaaagtagatgaattcaatgta
tctagtcctcagtttgttggaaaccttcgggagagtcctcttggacaggagaaggcactt
gaacagatactggaatatgaactacttcttatacagcaacttaatttccaccttattgtc
cacaatccttacagaccatttgagggcttcctcatcgacttaaagacccgctaccccatg
ttggagaatccagagattttgaggaaaacagctgatgactttcttaatagaattgcattg
acggatgcctaccttttatacacaccttcccaaattgccctgactgccattttatctagt
gcctccagggctggaattactatggaaagttatttatcagagagtctgatgctgagagag
aacagaacttgcctgtcacagttactagatataatgaaaagcatgagaaacttagtaaaa
aagtatgagccacccagatctgaagaagttgctgttctgaaacagaagttggagcgatgt
cattctgctgagcttgcacttaatgtaatcacgaagaagaggaaaggctatgaagatgat
gattacgtctcaaagaagtccaaacatgaggaggaagaatggactgacgacgacctggta
gaatctctctaa

DBGET integrated database retrieval system