KEGG   Macaca mulatta (rhesus monkey): 694340Help
Entry
694340            CDS       T01028                                 

Gene name
USP45
Definition
ubiquitin specific peptidase 45
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
mcc  Macaca mulatta (rhesus monkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 815 aa AA seqDB search
MRVKDPSKALPEKAKRSKRPTVPHEEDSSDDIAVGLTCQHVSHAISVNHVKRAIAENLWS
VCSECLKERRFYDGQPVLPSDIWLCLKCGFQGCGKNSESQHSLKHFKNSRIEPHCIIINL
STWIIWCYECDEKLSTHCNKKVLAQIVDFLQKHASKTQTSAFSRIMKLCEEKCETDEIKK
GGKGRSLSSVRGITNLGNTCFFNAVMQNLAQTYTLTDRMNEIKESSTKLKIFPSSDSQLD
PLVVELSRPGPLTSALFLFLHSMKETEKGPLSPNVLFNQLCQKAPRFKDFQQQDSQELLH
YLLDAVRTEETKRIQASILKAFNNPTTKTADDETRKKVKAYGKEGVKMNFIDRIFIGELT
STVMCEECANISTVKDPFIDISLPIIEERVSKPLLLGRMNKYRSLRETDHDRYNGNVTVE
NIHQPRAAKKHSSSKDKSQLIHDRKCIRKLSGETVVTYQKKENLEMNGDSLMFARLMNSE
SPLNESPTDDSEKEASHSESNVDADSEASESESASKQTELFRSSSGSGVHTDGPLYPPSA
GELVYNKETDSGDKQMAEAISELHLRSTVTGHQDFDRENQPLSISNNLCFLEGKHLRPHS
PQNAFQTLSQTYITTSKECSVQSCLYQFTSMELLMGNNKLLCENCTKNKQKYQEETSFAE
KKVEGVYTNARKQLLISAVPAVLILHLKRFHQAGLSLRKVNRHVDFPLMLDLAPFCSATC
KNASMGDKVLYGLYGIVEHSGSMREGHYTAYVKVRTPSRKLSEHPTKKKSVPGLKEADSE
SAGQWVHVSDTYVQVVPESRALSAQAYLLFYERVL
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtgaaagatccaagtaaagctttacctgagaaagccaaaagaagtaaaaggcct
actgtacctcatgaagaagactcttcagatgatattgctgtaggtttaacttgccaacat
gtaagtcatgctatcagcgtgaatcatgtaaagagagcaatagctgagaatctgtggtca
gtttgctcagaatgtttaaaagaaagaagattctatgatgggcagccagtacttccttct
gatatttggttgtgcctcaagtgtggcttccagggatgtggtaaaaactcagaaagccag
cattcactgaagcacttcaagaattccagaatagagccccattgtatcataattaatctg
agcacatggattatatggtgttatgaatgtgatgaaaaattatcaacgcattgtaataag
aaggttttggctcagatagttgattttctccagaaacatgcttctaaaacacaaacaagt
gcattttctagaatcatgaaactttgtgaagaaaaatgtgaaacagatgaaataaagaag
ggaggaaaaggcagaagtttatcatctgtaagaggaattacaaatttaggaaatacttgc
ttttttaatgcagtcatgcagaacttggcacagacttatactcttactgatcggatgaat
gagatcaaagaaagtagtacaaaactcaagatttttccttcctcagactctcagctggac
ccgttagtggtggaactttcaaggcctggaccactgacctcagccttgttcctgtttctt
cacagcatgaaggagactgaaaaaggaccactttctcctaacgttctttttaatcagctt
tgtcagaaggcacctcgatttaaagatttccagcaacaggacagtcaggagcttcttcat
tatcttctggatgcagtgaggacagaagaaacaaagcgaatacaagctagcattctaaaa
gcatttaacaacccaactactaaaactgctgatgatgaaactagaaaaaaagtcaaagca
tatggaaaagaaggtgtgaaaatgaacttcatagatcggatctttattggtgaattaact
agcacggtcatgtgtgaagaatgtgcaaatatctccacggtgaaagatccgttcattgat
atttcacttcctataattgaagaaagggtttcaaaacctttgcttttgggaagaatgaat
aaatatagaagtttacgagagacagatcatgatcgatacaatggcaatgttactgtagaa
aatattcatcaacctagagctgccaagaagcattcttcatctaaagataagagtcaacta
attcatgaccgaaaatgtattaggaaattgtctggagaaactgttgtcacataccagaaa
aaggaaaaccttgaaatgaatggggattctttaatgtttgcaagactcatgaattctgag
tcacctctgaatgaaagccctactgatgacagtgaaaaagaagccagccattctgaaagt
aatgttgatgctgacagtgaggcttcagaatctgaaagtgcttcaaagcagactgagctg
ttcagatccagtagtggatctggtgtgcacacagatggacccctttaccctccatcagca
ggtgaactggtgtacaacaaggagactgacagtggtgataagcaaatggctgaggctatt
tctgaacttcatttgaggagcactgtaactggacatcaagattttgacagagaaaatcag
ccactaagtatttcaaataatttatgttttttagaggggaagcatttgaggcctcatagt
ccccaaaatgcttttcagaccctttctcagacctatataactacttctaaagaatgttca
gttcagtcctgtctctaccagtttacatctatggaattactaatggggaataataagctt
ctatgtgagaactgtactaaaaacaaacagaagtaccaagaagaaaccagttttgcagaa
aagaaagtagaaggagtttatactaatgccaggaagcaattgctcatttctgctgttcca
gctgtcctaattctccatctgaaaagatttcatcaggctggcttgagtcttcgtaaagta
aacagacatgtagattttccacttatgctcgatttagcaccattctgttctgctacttgt
aagaatgcaagcatgggagataaagttctctacggtctctatggcatagtggaacatagt
ggctcgatgagagaaggccactacactgcttatgtgaaagtgagaacaccctccaggaaa
ttatcggaacatcccactaaaaagaaaagtgtgcctggtttgaaagaggctgatagtgaa
tcagcaggccagtgggtccatgttagtgacacttacgtacaggtggttccagaatcaaga
gcacttagtgcacaagcctaccttcttttctatgaaagagtattataa

DBGET integrated database retrieval system