KEGG   Macaca mulatta (rhesus monkey): 694418Help
Entry
694418            CDS       T01028                                 

Gene name
PGAM1
Definition
(RefSeq) phosphoglycerate mutase 1 (brain)-like
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Glucagon signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    694418 (PGAM1)
   01230 Biosynthesis of amino acids
    694418 (PGAM1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    694418 (PGAM1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    694418 (PGAM1)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    694418 (PGAM1)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    694418 (PGAM1)
Enzymes [BR:mcc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     694418 (PGAM1)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   694418 (PGAM1)
  Exosomal proteins of melanoma cells
   694418 (PGAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 254 aa AA seqDB search
MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHQEAKRRGQALRDAGSEFDICFTSVQ
KRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYD
VPPPPMEPDHPFYSNISKDRRYADLTEDHLPSCESLKDTIARALPFWNEEIVPQIKEGKR
VLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVR
KAMEAVAAQGKAKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggctgcctacaagctggtgctgatccggcacggcgagagcgcatggaacctggagaac
cgcttcagcggctggtacgacgctgacctgagcccagcgggccaccaggaggcaaagcgc
cgcgggcaggcgctgcgagatgctggctctgagtttgacatctgcttcacctcagtacag
aagagagcgatccggaccctctggacagtgctagatgccattgatcagatgtggctgcca
gtggtgaggacttggcgcctcaatgagcggcactatgggggtctaactggtctcaataaa
gcagaaactgctgcaaagcatggtgaggcccaggtgaagatctggaggcgctcctatgat
gtcccaccacctccgatggagcccgaccaccctttctacagcaacatcagtaaggatcgc
aggtatgcagacctcacagaagatcacctaccctcctgtgagagtctgaaggacactatt
gccagagctctgcccttctggaatgaagaaatagttccccagatcaaggaggggaaacgt
gtactgattgcagcccatggcaatagcctccggggcattgtcaagcatctggagggtctc
tctgaagaggctatcatggagctgaacctgccgactggtattcccattgtctatgaattg
gacaagaacttgaagcctatcaagcccatgcagtttctgggggatgaagagacggtgcgc
aaagccatggaagctgtggccgcccagggcaaggccaagaagtga

DBGET integrated database retrieval system