KEGG   Macaca mulatta (rhesus monkey): 694444Help
Entry
694444            CDS       T01028                                 

Gene name
MAPK6
Definition
mitogen-activated protein kinase 6
Orthology
K06855  
mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     694444 (MAPK6)
Protein kinases [BR:mcc01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   694444 (MAPK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
18
AA seq 744 aa AA seqDB search
MPVFFLVYTSSIRKEKANSKGFKMAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSA
VDNDCDKRVAIKKIVLTDPQSVKHALREIKIIRRLDHDNIVKVFEILGPSGSQLTDDVGS
LTELNSVYIVQEYMETDLANVLEQGPLLEEHARLFMYQLLRGLKYIHSANVLHRDLKPAN
LFINTEDLVLKIGDFGLARIMDPHYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWA
AGCIFAEMLTGKTLFAGAHELEQMQLILESIPVVHEEDRQELLSVIPVYIRNDMTEPHKP
LTQLLPGISREALDFLEQILTFSPMDRLTAEEALSHPYMSIYSFPMDEPISSHPFHIEDE
VDDILLMDETHSHIYNWERYHDCQFSEHDWPIHNNFDIDEVQLDPRALSDVTDEEEVQVD
PRKYLDGDREKYLEDPAFDTSYSTEPCWQYSDHHENKYCDLECSHTCNYKMRSSSYLDNL
VWRESEVNHYYEPKLIIDLSNWKEQSKEKSDKKGKSKCERNGLVKAQIALEEASQQLAGK
EREKNQGFDFDSFIAGTIQLSSQHEPTDVVDKLNDLNSSVSQLELKSLISKSVSQEKQEK
GMANLAQLEALYQSSWDSQFVSGGEDCFFINQFCEVRKDEQVEKENTYTSYLDKFFSRKE
DTEMLETEPVEDGKLGERGHEAGFLNNSGEFLFNKQLESIGIPQFHSPVGSPLKSIQATL
TPSAMKSSPQIPHKTYSSILKHLN
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgccagttttcttccttgtttacacaagttcaattcgaaaggaaaaggcaaatagtaag
ggtttcaaaatggcagagaagtttgaaagtctcatgaacattcatggttttgatctgggt
tctaggtatatggacttaaaaccattgggttgtggaggcaatggcttggttttttctgct
gtagacaatgactgtgacaaaagagtagccatcaagaaaattgtccttactgatccccag
agtgtcaaacatgctctacgtgaaatcaaaattattagaagacttgaccatgataacatt
gtgaaagtgtttgaaattcttggtcctagtggaagccaattaacagacgatgtgggctct
cttacggaactgaacagtgtttacattgttcaggagtacatggagacagacttggctaat
gtgctggagcagggccctttactggaagagcatgccaggctgttcatgtatcagctgcta
cgggggctcaagtatattcactctgcaaacgtactgcacagagatctcaaaccagctaat
cttttcattaatactgaagacttggtgctgaagataggtgactttggtcttgcacggatc
atggatcctcattattcccataagggtcatctttctgaaggattggttactaaatggtac
agatctccacgtcttttactttctcctaataattatactaaagccattgacatgtgggct
gcaggctgcatctttgctgaaatgctgactggtaaaaccctttttgcaggtgcacatgaa
cttgaacagatgcagctgattttagaatctattcctgttgtacatgaggaagatcgtcag
gagcttctcagtgtaattccagtttacattagaaatgacatgactgagccacacaaacct
ttaactcagctgcttccaggaattagtcgagaagcactggatttcctggaacaaattttg
acatttagtcccatggatcggttaacagcagaagaagctctctcccatccttacatgagc
atatattcttttccaatggatgagccaatttcaagccatccttttcatattgaagatgaa
gttgatgatattttgcttatggatgaaactcacagtcacatttataactgggaaaggtat
catgattgtcagttttcagagcatgattggcctatacataacaactttgatattgatgag
gttcagcttgatccaagagctctgtccgatgtcactgatgaagaagaagtacaagttgat
ccccgaaaatatttggatggagatcgggaaaagtatctagaggatcctgcttttgatacc
agttactctactgagccttgttggcaatactcagatcatcatgaaaacaaatattgtgat
ctggagtgtagccatacttgtaactacaaaatgaggtcgtcatcgtatttagataactta
gtttggagagaaagtgaagttaaccattactatgaacccaagcttattatagatctttcc
aattggaaagaacaaagcaaagaaaaatctgataagaaaggcaaatcaaaatgtgaaagg
aatggattggttaaagcccagatagcgctagaggaagcatcacagcaactggctggaaaa
gaaagggaaaagaatcagggatttgattttgattcctttattgcaggaactattcaactt
agttcccaacatgagcctactgatgttgttgataaattaaatgacttgaatagctcagtg
tcccaactagaattgaaaagtttgatatcaaagtcagtaagccaggaaaaacaggaaaaa
ggaatggcaaatctggctcaattagaagccttgtaccaatcttcttgggacagccagttt
gtgagtggtggggaggactgttttttcatcaatcagttttgtgaggtaaggaaggatgaa
caagttgagaaggaaaacacttacactagttacttggacaagttctttagcaggaaagaa
gatactgaaatgctagaaactgagccagtagaggatgggaagcttggggagagaggacat
gaggcaggatttctgaacaacagtggggagttcctcttcaacaagcagcttgagtccata
ggcatcccgcagtttcacagtccagttgggtcaccacttaagtcaatacaggccacatta
acaccttctgctatgaaatcttcccctcaaattcctcataaaacatacagcagcattctg
aaacatctgaactaa

DBGET integrated database retrieval system