KEGG   Macaca mulatta (rhesus monkey): 694629Help
Entry
694629            CDS       T01028                                 

Gene name
STAMBPL1
Definition
STAM binding protein-like 1 (EC:3.1.2.15)
Orthology
K11867  
AMSH-like protease [EC:3.1.2.15]
Organism
mcc  Macaca mulatta (rhesus monkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 436 aa AA seqDB search
MDQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNITISEDITPRRYFRSGVEMER
MASVYLEEGNLENAFVLYNKFITLFVEKLPNHRDYQQCAVPEKQDIMKKLKEIAFPRTDE
LKNDLLKKYNVEYQEYLQSKNKYKAEILKKLEHQRLIEAERKRIAQMRQQQLESEQFLFF
EDQLKKQELARGQMRSQQTSGLSEQIDGSALSCFSTQQNNSLLNVFADQPNKSDATNYAS
HSPPVNRALTPAATLSAVQNLVVEGLRCAVLPKDLCHKFLQLAESNTVRGIETCGILCGK
LTHNEFTITHVIVPKQSAGPDYCDVENVEELFNVQDQHDLLTLGWIHTHPTQTAFLSSVD
LHTHCSYQLMLPEAIAIVCSPKHKDTGIFRLTNAGMLEVSACKKKGFHPHTKEPRLFSIC
KHVLVKDIKIIVLDLR
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggatcagccttttactgtgaattctctgaaaaagttagctgctatgcctgaccataca
gatgtttccctaagcccagaagagcgagtccgtgccctaagcaaacttggttgtaatatc
accatcagtgaagacatcactccacgacgttactttaggtctggagtagagatggagagg
atggcgtctgtgtatttggaagaaggaaatttggaaaatgcctttgttctttataataaa
tttataaccttgtttgtagaaaagcttcctaaccatcgagattaccagcaatgtgcagta
cctgaaaagcaggatattatgaagaaactgaaggaaattgcattcccaaggacagatgaa
ttgaaaaacgaccttttaaagaaatataacgtagaataccaagaatatttgcaaagcaaa
aacaaatataaagctgaaattctcaaaaaactggagcatcagagattgatagaggcagaa
aggaagcggattgctcagatgcgccagcagcagctagaatcggagcagtttctgtttttc
gaagatcaactcaagaagcaagagttagcccgaggtcagatgcgaagtcagcaaacctcg
gggctgtcggagcagattgatgggagcgctttgtcctgcttttccacacagcagaacaat
tccttgctgaatgtatttgcagatcaacctaataaaagtgatgcaaccaattatgctagc
cactctcctcctgtaaacagggccttaacgccagctgctactctaagtgctgttcagaat
ttagtggttgaaggactgcgatgtgcagttttgccaaaagatctttgccacaaatttctg
cagctggcagaatctaatacagtgagaggaatagaaacctgtggaatactctgtggaaaa
ctgacacataatgaatttactattactcatgtaattgtgccaaagcagtctgcgggacca
gactattgtgacgtggagaatgtagaggaattattcaatgtgcaggatcaacacgatctc
ctcactctaggatggattcatacccatcccactcaaactgcattcttatccagcgttgat
cttcacactcactgttcctatcaactcatgttaccagaggccattgccattgtttgctca
ccaaagcataaagacactggcatcttcaggctcaccaatgctggcatgcttgaggtttct
gcttgtaaaaaaaagggctttcatccacacaccaaggagcccaggctgttcagtatatgc
aaacatgtgttggtaaaagacataaaaataattgtgttggatctgaggtga

DBGET integrated database retrieval system