KEGG   Macaca mulatta (rhesus monkey): 694658Help
Entry
694658            CDS       T01028                                 

Gene name
SLC9A3R2
Definition
solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3 regulator 2
Orthology
K13358  
Na(+)/H(+) exchange regulatory cofactor NHE-RF2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Organismal Systems
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    694658 (SLC9A3R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
20
AA seq 261 aa AA seqDB search
MAGMDAVQMLVVDQETDEELRRRQLTCTEEMAQRGLPPAHDPWEPKPDWAHMGGRSSDAG
KKDVSGPLRELRPRLCHLQKGPQGYGFNLHSDKSRPGQYIRSVDLGSPAARSGLRAQDRL
IEVNGQNVEGLRHAEVVASIKAREDEARLLVVDPETDEHFKRLRVTPTEEHVEGPLPSPV
TNGTSPVQLNGGSACSSRSDLPGSDKDTEDGSAWKRDPFQESGLHLSPTAAEAKEKARAT
RVNKRAPQMDWNRKREIFSNF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcgggaatggacgcggtgcagatgctggtggtggaccaggagacagatgaggagctc
cgccggcggcagctgacctgcactgaggagatggcccagcgagggctcccgcccgcccac
gacccctgggagccaaagccagactgggcacacatgggtggccgcagctccgacgctggc
aagaaggatgtcagtgggcccctgagggagctgcgccctcggctctgccacctgcaaaag
ggacctcagggctatgggttcaacctgcatagtgacaagtcccggcccggccagtacatc
cgctcggtggacctgggctcacctgctgcccgctctggcctccgcgcccaggaccggctt
attgaggtgaacgggcagaatgtggaggggctgcgccacgctgaggtggtggccagcatc
aaggcacgggaggatgaggcccggctgctggtggtggaccccgagacagatgagcacttc
aagcggcttcgggtcacacccaccgaggagcatgtggaaggtcctctgccatcacccgtg
accaacggaaccagccctgtccagctcaatggtggctctgcgtgctcgtcccgaagtgac
cttcctggttctgacaaggacactgaggatggcagtgcctggaagcgagaccccttccag
gagagcggcctccacctgagccccacggcggccgaggccaaggagaaggctcgagccacg
cgagtcaacaagcgcgcgccgcagatggactggaacaggaagcgcgaaatcttcagcaac
ttctga

DBGET integrated database retrieval system