KEGG   Macaca mulatta (rhesus monkey): 694825Help
Entry
694825            CDS       T01028                                 

Gene name
ADRA2B
Definition
adrenoceptor alpha 2B
Orthology
K04139  
adrenergic receptor alpha-2B
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
cGMP-PKG signaling pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    694825 (ADRA2B)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    694825 (ADRA2B)
G protein-coupled receptors [BR:mcc04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    694825 (ADRA2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 445 aa AA seqDB search
MDHQDPYSVQATAAIAAVITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADIL
VATLIIPFSLANELLGYWYFWRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEY
NSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGS
FFAPCLIMILVYLRIYLIAKRSNRRGPRAKGGPGQGESKQPRPNRGGALASAKLPALASL
ASAREVNGHSKSTGEKEEGETSEDTVTRALPPSWAALPDSGQGQKEGVCGASPEDEAEEE
EEEECEPQEGPVSAASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGAQWWRRRAQLTR
EKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNSSLNPVI
YTIFNQDFRRAFRRILCRPWTQTAW
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggaccaccaggacccctactccgtgcaggccacggcggccatcgcggcggtcatcacc
ttcctcatcctcttcaccatcttcggcaacgcgctggtcatcctggctgtgttgaccagc
cgctcgctgcgcgcccctcagaacctgttcctggtgtcgctggccgccgccgacatcctg
gtggccacgctcatcatccctttctcgctggctaacgagctcctcggctactggtacttc
tggcgcacgtggtgcgaggtgtacctggcgctggacgtgctcttctgcacctcgtccatc
gtgcacctgtgcgccatcagcctggaccgctactgggccgtgagccgcgcgctggagtac
aactccaagcgcaccccgcgccgcatcaagtgcatcatcctcaccgtgtggctcatcgcc
gccgtcatctcgctgccgcccctcatctacaagggtgaccagggcccccagccgcgcggg
cgcccccagtgcaagctcaaccaggaggcctggtacatcctggcctccagcatcggatcg
ttctttgctccttgcctcatcatgatccttgtctacctgcgcatctacctgatcgccaaa
cgcagcaaccgcagaggtcccagggccaagggggggcctgggcagggtgagtccaagcag
ccccgacccaaccgtggtggggctttggcctcagccaagctgccagccctggcttctctg
gcttctgccagagaggtcaatggacactcgaagtccactggggagaaggaggagggggag
acctctgaagatactgtgacccgggccttgccacccagttgggctgcccttcccgactca
ggccagggccagaaggaaggtgtttgtggggcatctccagaggatgaagctgaagaggag
gaggaggaagagtgtgaaccccaggaagggccagtgtctgcggcctcagcttgcagcccc
ccgctgcagcagccacagggctcccgggtgctggccaccctacgtggccaggtgctcctg
ggcaggggcgtgggtgctataggtgcgcagtggtggcgtcgacgggcacagctgacccgg
gagaagcgcttcaccttcgtgctggccgtggtcattggcgtttttgtgctctgctggttc
ccctttttcttcagctacagcctgggcgccatttgcccgaagcactgcaaggtgccccat
ggcctcttccagttcttcttctggatcggctactgcaacagttcgctgaaccctgtcatt
tacaccattttcaaccaggacttccgccgtgccttccggaggatcctgtgccgcccatgg
acccagacagcctggtga

DBGET integrated database retrieval system