KEGG   Macaca mulatta (rhesus monkey): 694946Help
Entry
694946            CDS       T01028                                 

Gene name
PGAM1
Definition
phosphoglycerate mutase 1 (brain) pseudogene
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Glucagon signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    694946 (PGAM1)
   01230 Biosynthesis of amino acids
    694946 (PGAM1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    694946 (PGAM1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    694946 (PGAM1)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    694946 (PGAM1)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    694946 (PGAM1)
Enzymes [BR:mcc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     694946 (PGAM1)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   694946 (PGAM1)
  Exosomal proteins of melanoma cells
   694946 (PGAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
15
AA seq 241 aa AA seqDB search
MATYKLVLIRCGDSTWNLENHFSSWYDANLILVGHEEAKRGGQALRDASYEFDICFPSRE
ESDQTLWTVLDAIDQMWLPVLRTWCLKEWHYEGLTGLNKAETAAKHGEAQVKIWRRSYDV
PPPPMEPNHLFYSNNSKNCRYADLTEDQLSSGESLKEIVPQIKEGKWVLTAGHGNSLWGI
VKHLEGLSEEAIMEVNLPTGIRIVYELEKNLKPIKPMQFLGDEATVHKAMEAVAAQGKAK
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggccacctacaagttagtattgatcaggtgtggtgacagcacgtggaacctggagaat
cacttcagcagctggtatgatgccaacctaatcctggtaggccatgaggaggcaaagcgc
ggtgggcaggctctgcgagatgctagctatgagtttgacatctgctttccctctagggaa
gagagcgatcaaaccctctggacggtgctagatgccattgatcagatgtggctaccagta
ttgaggacttggtgcctcaaggagtggcattatgagggtctgactggcctcaataaagca
gaaactgctgcgaagcatggcgaggcccaggtgaagatctggaggcgctcctatgatgtc
ccaccacctccgatggagcccaaccatcttttctacagcaacaacagtaagaattgcagg
tatgcagacctcactgaagatcagctatcctccggtgagagtctgaaggaaatagttcct
cagatcaaagaggggaaatgggtactgactgcaggccatggcaacagcctttggggcatt
gtcaagcatctggagggtctctctgaagaggctatcatggaggtgaacctgccgactggt
attcgcattgtctatgaactggaaaagaacttgaagcccatcaagcccatgcaattcctg
ggggatgaagctactgtgcataaagccatggaagctgtggctgcccagggcaaggctaag
aagtga

DBGET integrated database retrieval system