KEGG   Macaca mulatta (rhesus monkey): 694964Help
Entry
694964            CDS       T01028                                 

Gene name
PDIA2
Definition
protein disulfide isomerase family A, member 2 (EC:5.3.4.1)
Orthology
K09581  
protein disulfide isomerase family A, member 2 [EC:5.3.4.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     694964 (PDIA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
20
AA seq 524 aa AA seqDB search
MSHQLLPVLLLLLRASCPWGQEQGPKSPSEEPPEEEIPKEDGILVLSRHTLGLALREHPA
LLVEFYAPWCGHCKALAPEYSKAAALLAAESTAVTLSKVDGPAQPELAEEFGVTEYPTLK
FFRNGNRTHPEEYTGPREAEGIAEWLRRRVGPSAMRLEDEAAAQALIDGRDLVVIGFFQD
LQDEDVATFLALARDALDMTFGLTDRPRLFEQFGLTKDTVVLFKKFDEGRADFPVDEELG
LDLGDLSRFLVTHSMHLVTEFNSQTSPKIFAARILNHLLLFVNQTLAAHRELLAGFGEAA
PHFRGQVLFVVVDVAADNEHVLQYFGLKAEAAPTLRFINVETTKKYAPVDGGPVTAASVT
AFCDAVLNGQVKPYLLSQEVPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTHC
KEMAPAWEALAEKYQDHEDIIIAQLDATANELDAFAVHSFPTLKYFPAGPGRKVIEYKSA
RDLETLSKFLDNGGAVPTEEPTEEPAAPFPEPRANSTVGSKEEL
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgagccaccagcttctgcctgtactgctgctgctgctcagggcttcgtgcccctggggt
caggagcagggacccaagagcccctcagaggagcctccagaggaggaaatccccaaggag
gatgggatcttggtgctgagccgccacaccctgggcctggccctgcgggagcaccctgcc
ttgctggtggagttctatgccccgtggtgtgggcactgcaaggccctggcccccgagtac
agcaaggcagctgccctgctcgcggccgagtcaacggcggtcacgctgtccaaggtggac
gggcctgcgcagcccgagctggctgaggagttcggtgtgacggagtaccctacgctcaag
ttcttccgcaacgggaaccgcacacacccggaggagtacacaggaccacgggaggctgag
ggcattgccgagtggctgcgacggcgggtggggcccagtgccatgcggctggaggacgag
gcggccgcccaggcgctgatcgatggccgggacctggtggtcatcggcttcttccaggac
ctgcaggatgaggacgtggccaccttcttagccctggcccgggacgccctggacatgacc
tttggcctcacggaccggccgcggctctttgagcagtttggcctcaccaaggacaccgtg
gttctcttcaagaagtttgatgaggggcgggcagacttcccagtggatgaggagcttggc
ctggacctgggggatctgtcgcgcttcctggtcacacacagcatgcacctggtcacggag
ttcaacagccagacatctcccaagatcttcgcggccaggatcctcaaccacctgctgctg
tttgtcaaccagaccctggctgctcacagggagctcctagccggctttggggaggcagct
ccccacttccgggggcaggtgctgttcgtggtggtggacgtggcggctgacaatgagcac
gtgctgcagtactttggcctcaaggctgaggcagcccccaccctgcgcttcatcaacgtt
gagaccactaaaaagtacgcgcctgtggatgggggccctgtcaccgcagcttccgtcact
gctttctgcgacgcagtcctcaacggccaagtcaagccctatctcctgagccaggaggta
ccccctgactgggatcagcggccagtgaagaccctcgtgggcaagaattttgagcaggtg
gcttttgacgaaaccaagaatgtgtttgtcaagttctacgccccatggtgcacccattgc
aaggagatggcccctgcctgggaggcgctggctgagaagtaccaagaccatgaggacatc
atcattgctcagctggatgccacggccaacgagctggacgccttcgccgtgcacagcttc
cctaccctcaagtacttcccagcagggccgggtcggaaggtgattgaatataaaagcgcc
agggacctggagaccttgtccaagttcctggacaacgggggcgcggtgcccacggaggag
cccacggaggagccggcagccccgttcccggagccacgggccaactcaaccgtggggtcc
aaggaggagctgtag

DBGET integrated database retrieval system