KEGG   Macaca mulatta (rhesus monkey): 695030Help
Entry
695030            CDS       T01028                                 

Gene name
MGAM
Definition
maltase-glucoamylase (alpha-glucosidase)
Orthology
K12047  
maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Carbohydrate digestion and absorption
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mcc00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mcc00500]
Organismal Systems; Digestive system; Carbohydrate digestion and absorption [PATH:mcc04973]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 2104 aa AA seqDB search
MARKKLQKFTTLEIVLSVLLLVLFIISIVLIVLLAKESLKSTAPDPGTTGTPDPGTTTST
QSRTTGPPDPGTTGTTPVSAECPVVNELERINCIPDQPPTKATCDQRGCCWNPQGAVSVP
WCYYSKNHSYHMEGDLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLT
DQTSSRFEVPHEHVQSFSGNAAASLTYRVEISREPFSIKVTRRSNNRVLFDSSIGPLLFA
NQFLQLSTRLPSANVYGLGEHVHQQYRHDMNWKTWPIFKRDTTPNGNGSNLYGAQTFFLC
LEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTTGGILDFYVFLGNTPEQVVQEYLELIG
RPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDPV
NFKGFPEFVNDLHKNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLI
GEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNN
LNNPPFTPRVLDGYLFCKTLCMDAVQHWGKQYDVHNLYGYSMAVATAEAAKTVFPNNRSF
ILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGADICGFALDAPEE
LCRRWMQLGAFYPFSRNHNGQGFKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFF
RAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYD
YETGNQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENK
EAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTE
EPSNVTVKHNGIPTQTSPTVTYDSNLKVAIITDINLLLGEAYTVEWDIKIRDDEKIDCYP
DENGASAENCAARGCIWEASNSSGVPFCYFVNDLYSVSNVQYSSHGATADISLKSSVYAN
AFPSTPVNPLHLDVTYHKNEMLQFKIYDPNNNRYEVPVPLNVPTVPSSTPEGQLYDVLIK
KNPFGVEIRRKSTGTIIWDSQLLGFTFNDMFIRISTRLASKYLYGFGETEHTSYRRDLEW
HTWGMFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVFLLNSNAMDVTFQPLPALTYRTT
GGVLDFYVFLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDSEIASLYDEMVA
AQIPYDVQYSDIDYMERQLDFTLSPKFAGFPALINRMKADGMRVILILDPAISGNETQPY
PAFTRGLEDDVFIKYPNDGDIVWGKVWPDFPGVVVNDSLDWDSQVELYRAYVDMNEPSSF
VNGAVSPGCRDTSLNRPPYMPYLESRDRGLSSKTLCMESQQILPDGSPVQHYNVHNLYGW
SQTRPTYEAMQEVTGQRGVVITRSTFPSSGRWAGHWLGDNTAAWDQLKKSIIGMMEFSLF
GISYTGADICGFFQDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWDTAFVNISRN
VLQTRYTLLPYLYTLIYQAHTEGVTVVRPLLHEFVSDQVTWDIDSQFLLGPAFLVSPVLE
RNARNVTAYFPRARWYDYYTGVDIDARGEWKTLPAPLDYINLHIRGGYILPWQEPAVNTH
LSRKNPLGLIIALDENKEAKGELFWDDGQTKGERCYDHVAVSKPTPVTYDPSLLLVIELW
EKSQQAQQQVTENRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSQTSPT
VTYDSNLKVAIITDINLLLGEAYTVEWDIKTRDDEKIDCYPDENGASAENCIARGCIWEA
SNSSGVPFCYFVNDLYSVSNVQYNSHGATADISLKSSVYANAFPSTPVNPLRLDVTYHKN
EMLQFKIYDPNNNRYEVPVPLNVPMVPSGTREGQLYDVLIKKNPFGIEIRRRSTGTIIWD
SQLLGFTFNDMFIRISTRLPSKYLYGFGETEHTSYRRDLEWHTWGMFSRDQPPGYKKNSY
GVHPYYMGLEEDGSAHGVFLLNSNAMDVTFQPLPALTYRTTGGVLDFYVFLGPTPELVTQ
QYTE
NT seq 6312 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaagctgcaaaaatttactactttggagattgtgctcagtgttcttctg
ctcgtgttgtttatcatcagtattgttctaattgtgcttttagccaaggagtcattgaaa
tcaacagccccagatcccgggacaactggtaccccagatcctggaacaaccacttccacg
cagtctaggacaactggtcccccagatcctggaacaactggtaccactcctgtttctgct
gaatgtcccgtggtaaatgaattggaacgaattaattgcatccctgaccagccaccaaca
aaggccacatgtgaccaacgtggctgttgctggaatccccagggagctgtaagtgttccc
tggtgctactattccaagaatcatagctaccacatggagggcgaccttgtaaacacaaat
gcaggattcacagcccggttgaaaaatctgccttcttcacccgtgttcggaagcaatgtt
gacaatgttcttctcacagcagaatatcagacatctaatcgtttccactttaagttgacc
gaccaaaccagtagcaggtttgaagtaccccacgaacatgtgcagtccttcagtggaaat
gctgctgcttctttgacctaccgagttgaaatctccagagagccatttagcatcaaagtg
accagaagaagcaacaatcgtgttttgtttgactcaagcattgggcccctcctgtttgcc
aaccagttcttgcagctttccacccgactgcctagtgctaatgtgtatggcctgggagag
catgtgcaccagcagtaccggcatgatatgaattggaagacctggcccatatttaaaagg
gacacaactcccaatggaaacggaagtaatttgtatggtgcgcagacattcttcctgtgt
cttgaagatgctagtggattgtcctttggggtgtttctgatgaacagcaatgccatggag
gttgtccttcagcctgcgccagccatcacttaccgcaccactgggggcattctcgacttc
tatgtgttcttgggaaacactccagagcaagttgttcaagaatatctagagcttattggg
cggccagcccttccctcctactgggcacttggatttcaccttagtcgttatgaatatgga
accttagacaacatgagagaagtcgtggagagaaatcgcgcagcacagctcccttatgat
gttcagcatgctgatattgattatatggatgagagaagggacttcacttatgatccagtg
aattttaaaggcttccctgaatttgtcaatgacttacacaaaaatggacagaagcttgtc
atcattgtggatccagccatctccaacaactcttcctcaagtaaaccctatggcccatat
gacaggggttcagatatgaagatatgggtgaatagttcagatggagtgactccactcatt
ggggaggtctggcctggacaaactgtgtttcctgattataccaatcccaactgtgctgtt
tggtggacaaaggaatttgaactttttcataatcaagtggagtttgatggaatctggatt
gatatgaatgaagtctccaactttgttgatggttcggtctcaggatgttccacaaacaac
ctaaataatcccccattcactcccagagtcctggatgggtacctgttctgcaagactctc
tgtatggatgcagtgcagcactggggcaagcagtatgacgttcacaatctgtatggctac
tccatggcggttgccacagcagaagctgccaagactgtgttccctaataacagaagcttc
attctgacccgttctacctttgcgggttctggcaagtttgcagcacattggttaggagac
aacaccgccacctgggatgacctgcgatggtccatccctggcgtccttgagttcaacctt
ttcggcatcccaatggtgggtgctgacatatgtggctttgccttggatgcccctgaggag
ctctgtaggcggtggatgcagttgggcgcattttatccattttctagaaatcacaatggc
caaggcttcaaggaccaggatcctgcctcctttggagctgactccctgctgttgaattcc
tccaggcactaccttaacatccgctatactctattgccctacctatacaccctcttcttc
cgtgctcacagccgaggggacacggtggccaggccccttttgcatgagttctatgaggac
aacagcacttgggatgtgcaccaacagttcttatgggggcccggcctcctcatcactcca
gttctggatgaaggtgcagagaaagtgatggcatatgtgcctgatgctgtctggtatgac
tacgagactggaaaccaagtgagatggaggaagcaaaaagtcgagatggaacttcctgga
gacaaaattggacttcaccttcgaggaggctacatctttcccacacagcagccaaataca
accactctggccagtcgaaagaaccctcttggtcttatcattgccctagatgagaacaaa
gaagcaaaaggagaacttttctgggatgatggggaaacgaaggatactgtggccaataaa
gtgtatcttttatgtgagttttctgtcactcaaaaccgcttggaggtgaatatttcacaa
tcaacctacaaggaccccaataatttagcatttaatgagattaaaattcttgggacggag
gaacctagcaatgttacagtgaaacacaatggtatcccaactcagacttctcctacagtc
acttatgattctaacctgaaggttgccattatcacagatatcaatcttctcctgggagaa
gcatacacagtggagtgggatataaagataagggatgatgaaaaaatagactgttaccct
gatgagaatggtgcttctgcagaaaactgtgctgcccgtggctgtatctgggaggcatcc
aattcttctggggtccctttttgctattttgtcaacgatctatactctgtcagtaatgtt
caatatagttcacatggggccacagctgacatctccttaaagtcttccgtgtatgccaat
gccttcccctccacacccgtgaacccccttcacctggatgtcacttaccataagaatgaa
atgctgcagttcaagatttatgatcccaacaacaatcggtatgaagttccagttcctctg
aacgtacccacggtgccatccagcacccctgagggtcaactctatgatgtccttattaag
aagaatccgtttggggttgaaattcgccgcaagagtacaggcactataatttgggactct
cagctccttggtttcaccttcaatgacatgtttatccgcatctccacccgccttgcctcc
aagtacctctatggctttggggaaactgagcacacatcctataggagagacttggagtgg
cacacttgggggatgttctcccgagaccagcccccagggtacaagaagaattcctatggt
gtccacccctactacatggggctggaggaggatggcagtgcccacggagtgttcctgctg
aacagcaatgccatggacgtgacgttccagcccctgcctgccttgacataccgtaccaca
gggggagttctggacttttatgtgttcttggggccaactccagagcttgtcacccagcag
tacacggagttgattggccggcctgtgatggtaccttactggtctttgggtttccagctg
tgtcgctatggataccagaacgactctgagatcgccagcttgtatgatgagatggtggcc
gcccagatcccttatgacgtgcagtactcagacatcgactacatggagcggcagctggac
ttcaccctcagccccaagtttgctgggtttccagctctgatcaatcgcatgaaggctgat
gggatgcgggtcatcctcattctggatccagctatttctggcaatgagacacagccctat
cctgccttcactcggggcttggaggatgacgtcttcatcaaatacccaaatgatggagac
attgtctggggaaaggtctggcccgattttcctggtgttgttgtgaatgactctctagac
tgggacagtcaagtggagctatatcgagcttacgtggatatgaatgaaccatcaagcttc
gtgaatggggcagtttctccaggctgcagggacacctctctgaaccgccctccctacatg
ccatatttggagtccagggacaggggtctaagcagcaagaccctgtgcatggagagtcag
cagatcctcccagacggctccccggtgcagcactacaacgtgcacaacctgtacgggtgg
tcccagaccagacccacatacgaagccatgcaggaggtgacgggacagcgaggggtcgtc
atcacccgctccacatttccctcttctggccgctgggcaggacattggctgggagacaac
acggccgcgtgggatcagctgaagaaatctatcattggcatgatggagttcagcctcttc
ggcatatcctatacaggagcagatatctgtgggttctttcaagatgctgaatacgagatg
tgtgttcgctggatgcagctgggggccttttaccccttctcaagaaaccacaacaccatt
gggaccaggagacaagaccctgtgtcctgggatactgcttttgtgaacatttccagaaat
gtcctgcagaccagatacaccctgttgccatatctgtataccttgatatatcaggcccac
acggagggcgtcacggttgtgcggcctctgcttcatgagtttgtgtcagaccaggtgacg
tgggacatagacagtcagttcctgctgggcccagccttcctggtcagccctgtcctggag
cgcaatgccagaaatgtcactgcatatttccctagagcccgctggtacgattactacacg
ggtgtggatattgatgcaagaggagagtggaagaccttgccagcccctcttgactacatt
aatcttcatatccgtgggggctacatcctgccctggcaagagcctgcagtgaacacccac
ttaagtcgaaagaaccctcttggtcttatcattgccctagatgagaacaaagaagcaaaa
ggagaacttttctgggatgatgggcaaacgaagggtgagcgctgttacgatcatgttgct
gtttccaaacccacacctgtgacttatgatccttccctcctgctggtcattgagctgtgg
gagaaatctcagcaggcacagcagcaagtcactgaaaaccgcttggaggtgaatatttca
caatcaacctacaaggaccccaataatttagcatttaatgagattaaaattcttgggacg
gaggaacctagcaatgttacagtgaaacacaatggtgtcccaagtcagacttctcctaca
gtcacttatgattctaacctgaaggttgccattatcacagacatcaatcttctcctggga
gaagcatacacagtggagtgggatataaagacaagggatgatgaaaaaatagactgttac
cctgatgagaatggcgcttctgcagaaaactgcattgcccgtggctgtatctgggaggca
tccaattcttctggagtccctttttgctattttgtcaacgatctatactctgtcagtaat
gttcaatataattcacatggggccacagctgacatctccttaaagtcttccgtgtatgcc
aatgccttcccctccacacccgtgaacccccttcgcctggatgtcacttaccataagaat
gaaatgctgcagttcaagatttatgatcccaacaacaatcggtatgaagttccagttcct
ctgaacgtacccatggtgccatccggcacccgtgagggtcaactctatgatgtcctcatt
aagaagaatccatttgggattgaaattcgccgcaggagtacaggcactataatttgggac
tctcagctccttggcttcaccttcaatgacatgtttatccgcatctccacccgccttccc
tccaagtacctctatggctttggggaaactgagcacacatcctataggagagacttggag
tggcacacttgggggatgttctcccgagaccagcccccagggtacaagaagaattcctat
ggggtccacccctactacatggggctggaggaggacggcagtgcccacggagtgttcctg
ctgaacagcaatgccatggacgtgacgttccagcccctgcctgccttgacataccgtacc
acagggggagttctggacttttatgtgttcttggggccaactccagagcttgtcacccag
cagtacacggag

DBGET integrated database retrieval system