KEGG   Macaca mulatta (rhesus monkey): 695030Help
Entry
695030            CDS       T01028                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase
  KO
K12047  
maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    695030 (MGAM)
   00500 Starch and sucrose metabolism
    695030 (MGAM)
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    695030 (MGAM)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     695030 (MGAM)
    3.2.1.20  alpha-glucosidase
     695030 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3
AA seq 2142 aa AA seqDB search
MARKKLQKFTTLEIVLSVLLLVLFIISIVLIVLLAKESLKSTAPDPGTTGTPDPGTTTST
QSRTTGPPDPGTTGTTPVSAECPVVNELERINCIPDQPPTKATCDQRGCCWNPQGAVSVP
WCYYSKNHSYHMEGDLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLT
DQTSSRFEVPHEHVQSFSGNAAASLTYRVEISREPFSIKVTRRSNNRVLFDSSIGPLLFA
NQFLQLSTRLPSANVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGSNLYGAQTFFLC
LEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTTGGILDFYVFLGNTPEQVVQEYLELIG
RPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDPV
NFKGFPEFVNDLHKNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLI
GEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNN
LNNPPFTPRVLDGYLFCKTLCMDAVQHWGKQYDVHNLYGYSMAVATAEAAKTVFPNNRSF
ILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGADICGFALDAPEE
LCRRWMQLGAFYPFSRNHNGQGFKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFF
RAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYD
YETGNQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENK
EAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTE
EPSNVTVKHNGIPSQTSPTVTYDSNLKVAIITDINLLLGEAYTVEWDIKIRDDEKIDCYP
DENGASAENCAARGCIWEASNSSGVPFCYFVNDLYSVSNVQYSSHGATADISLKSSVYAS
AFPSTPVNPLRLDVTYHKNEMLQFKIYDPNNNRYEVPVPLNVPTVPSSTPEGQLYDVLIK
KNPFGVEIRRKSTGTIIWDSQLLGFTFNDMFIRISTRLASKYLYGFGETEHTSYRRDLEW
HTWGMFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVFLLNSNAMDVTFQPLPALTYRTT
GGVLDFYVFLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDSEIASLYDEMVA
AQIPYDVQYSDIDYMERQLDFTLSPKFAGFPALINRMKADGMRVILILDPAISGNETQPY
PAFTRGLEDDVFIKYPNDGDIVWGKVWPDFPGVVVNDSLDWDSQVELYRAYVAFPDFFRN
STAKWWKREIEELYNNPQNPERSLKFDGLWIDMNEPSSFVNGAVSPGCRDTSLNRPPYMP
YLESRDRGLSSKTLCMESQQILPDGSPVQHYNVHNLYGWSQTRPTYEAMQEVTGQRGVVI
TRSTFPSSGRWAGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGADICGFFQDAEYEMC
VRWMQLGAFYPFSRNHNTIGTRRQDPVSWDTAFVNISRNVLQTRYTLLPYLYTLIYKAHT
EGVTVVRPLLHEFVSDQVTWDIDSQFLLGPAFLVSPVLERNARNVTAYFPRARWYDYYTG
VDIDARGEWKTLPAPLDYINLHIRGGYILPWQEPAVNTHLSRKNPLGLIIALDENKEAKG
ELFWDDGQTKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSN
VTVKHNGVPSQTSPTVTYDSNLKVAIITDINLLLGEAYTVEWDIKTRDDEKIDCYPDENG
ASAENCIARGCIWEASNSSGVPFCYFVNDLYSVSNVQYNSHGATADISLKSSVYANAFPS
TPVNPLRLDVTYHKNEMLQFKIYDPNNNRYEVPVPLNVPMVPSGTPEGQLYDVLIKKNPF
GIEIRRRSTGTIIWDSQLLGFTFNDMFIRISTRLPSKYLYGFGETEHTSYRRDLEWHTWG
MFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVFLLNSNAMDVTFQPLPALTYRTTGGVL
DFYVFLGPTPELVTQQYTEVGRNPVVYQALIQHILDARAHIH
NT seq 6429 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaagctgcaaaaatttactactttggagattgtgctcagtgttcttctg
ctcgtgttgtttatcatcagtattgttctaattgtgcttttagccaaggagtcattgaaa
tcaacagccccagatcccgggacaactggtaccccagatcctggaacaaccacttccacg
cagtctaggacaactggtcccccagatcctggaacaactggtaccactcctgtttctgct
gaatgtcccgtggtaaatgaattggaacgaattaattgcatccctgaccagccaccaaca
aaggccacatgtgaccaacgtggctgttgctggaatccccagggagctgtaagtgttccc
tggtgctactattccaagaatcatagctaccacatggagggcgaccttgtaaacacaaat
gcaggattcacagcccggttgaaaaatctgccttcttcacccgtgttcggaagcaatgtt
gacaatgttcttctcacagcagaatatcagacatctaatcgtttccactttaagttgacc
gaccaaaccagtagcaggtttgaagtaccccacgaacatgtgcagtccttcagtggaaat
gctgctgcttctttgacctaccgagttgaaatctccagagagccatttagcatcaaagtg
accagaagaagcaacaatcgtgttttgtttgactcaagcattgggcccctcctgtttgcc
aaccagttcttgcagctttccacccgactgcctagtgctaatgtgtatggcctgggagag
catgtgcaccagcagtaccggcatgatatgaattggaagacctggcccatatttaacagg
gacacaactcccaatggaaacggaagtaatttgtatggtgcgcagacattcttcctgtgt
cttgaagatgctagtggattgtcctttggggtgtttctgatgaacagcaatgccatggag
gttgtccttcagcctgcgccagccatcacttaccgcaccactgggggcattctcgacttc
tatgtgttcttgggaaacactccagagcaagttgttcaagaatatctagagcttattggg
cggccagcccttccctcctactgggcacttggatttcaccttagtcgttatgaatatgga
accttagacaacatgagagaagtcgtggagagaaatcgcgcagcacagctcccttatgat
gttcagcatgctgatattgattatatggatgagagaagggacttcacttatgatccagtg
aattttaaaggcttccctgaatttgtcaatgacttacacaaaaatggacagaagcttgtc
atcattgtggatccagccatctccaacaactcttcctcaagtaaaccctatggcccatat
gacaggggttcagatatgaagatatgggtgaatagttcagatggagtgactccactcatt
ggggaggtctggcctggacaaactgtgtttcctgattataccaatcccaactgtgctgtt
tggtggacaaaggaatttgaactttttcataatcaagtggagtttgatggaatctggatt
gatatgaatgaagtctccaactttgttgatggttcggtctcaggatgttccacaaacaac
ctaaataatcccccattcactcccagagtcctggatgggtacctgttctgcaagactctc
tgtatggatgcagtgcagcactggggcaagcagtatgacgttcacaatctgtatggctac
tccatggcggttgccacagcagaagctgccaagactgtgttccctaataacagaagcttc
attctgacccgttctacctttgcgggttctggcaagtttgcagcacattggttaggagac
aacaccgccacctgggatgacctgcgatggtccatccctggcgtccttgagttcaacctt
ttcggcatcccaatggtgggtgctgacatatgtggctttgccttggatgcccctgaggag
ctctgtaggcggtggatgcagttgggcgcattttatccattttctagaaatcacaatggc
caaggcttcaaggaccaggatcctgcctcctttggagctgactccctgctgttgaattcc
tccaggcactaccttaacatccgctatactctattgccctacctatacaccctcttcttc
cgtgctcacagccgaggggacacggtggccaggccccttttgcatgagttctatgaggac
aacagcacttgggatgtgcaccaacagttcttatgggggcccggcctcctcatcactcca
gttctggatgaaggtgcagagaaagtgatggcatatgtgcctgatgctgtctggtatgac
tacgagactggaaaccaagtgagatggaggaagcaaaaagtcgagatggaacttcctgga
gacaaaattggacttcaccttcgaggaggctacatctttcccacacagcagccaaataca
accactctggccagtcgaaagaaccctcttggtcttatcattgccctagatgagaacaaa
gaagcaaaaggagaacttttctgggatgatggggaaacgaaggatactgtggccaataaa
gtgtatcttttatgtgagttttctgtcactcaaaaccgcttggaggtgaatatttcacaa
tcaacctacaaggaccccaataatttagcatttaatgagattaaaattcttgggacggag
gaacctagcaatgttacagtgaaacacaatggtatcccaagtcagacttctcctacagtc
acttatgattctaacctgaaggttgccattatcacagatatcaatcttctcctgggagaa
gcatacacagtggagtgggatataaagataagggatgatgaaaaaatagactgttaccct
gatgagaatggggcttctgcagaaaactgtgctgcccgtggctgtatctgggaggcatcc
aattcttctggggtccctttttgctattttgtcaacgatctatactctgtcagtaatgtt
caatatagttcacatggggccacagctgacatctccttaaagtcttccgtgtatgccagt
gccttcccctccacacccgtgaacccccttcgcctggatgtcacttaccataagaatgaa
atgctgcagttcaagatttatgatcccaacaacaatcggtatgaagttccagttcctctg
aacgtacccacggtgccatccagcacccctgagggtcaactctatgatgtccttattaag
aagaatccgtttggggttgaaattcgccgcaagagtacaggcactataatttgggactct
cagctccttggtttcaccttcaatgacatgtttatccgcatctccacccgccttgcctcc
aagtacctctatggctttggggaaactgagcacacatcctataggagagacttggagtgg
cacacttgggggatgttctcccgagaccagcccccagggtacaagaagaattcctatggt
gtccacccctactacatggggctggaggaggatggcagtgcccacggagtgttcctgctg
aacagcaatgccatggacgtgacgttccagcccctgcctgccttgacataccgtaccaca
gggggagttctggacttttatgtgttcttggggccaactccagagcttgtcacccagcag
tacacggagttgattggccggcctgtgatggtaccttactggtctttgggtttccagctg
tgtcgctatggataccagaacgactctgagatcgccagcttgtatgatgagatggtggcc
gcccagatcccttatgacgtgcagtactcagacatcgactacatggagcggcagctggac
ttcaccctcagccccaagtttgctgggtttccagctctgatcaatcgcatgaaggctgat
gggatgcgggtcatcctcattctggatccagctatttctggcaatgagacacagccctat
cctgccttcactcggggcttggaggatgacgtcttcatcaaatacccaaatgatggagac
attgtctggggaaaggtctggcccgattttcctggtgttgttgtgaatgactctctagac
tgggacagtcaagtggagctatatcgagcttacgtggccttcccagactttttccgtaat
tcaactgccaagtggtggaagagggaaatagaagaactgtacaacaatccacagaatcca
gagaggagcttgaagtttgatggcctgtggattgatatgaatgaaccatcaagcttcgtg
aatggggcagtttctccaggctgcagggacacctctctgaaccgccctccctacatgcca
tatttggagtccagggacaggggtctaagcagcaagaccctgtgcatggagagtcagcag
atcctcccagacggctccccggtgcagcactacaacgtgcacaacctgtacgggtggtcc
cagaccagacccacatacgaagccatgcaggaggtgacgggacagcgaggggtcgtcatc
acccgctccacatttccctcttctggccgctgggcaggacattggctgggagacaacacg
gccgcgtgggatcagctgaagaaatctatcattggcatgatggagttcagcctcttcggc
atatcctatacaggagcagatatctgtgggttctttcaagatgctgaatacgagatgtgt
gttcgctggatgcagctgggggccttttaccccttctcaagaaaccacaacaccattggg
accaggagacaagaccctgtgtcctgggatactgcttttgtgaacatttccagaaatgtc
ctgcagaccagatacaccctgttgccatatctgtataccttgatatataaggcccacacg
gagggcgtcacggttgtgcggcctctgcttcatgagtttgtgtcagaccaggtgacgtgg
gacatagacagtcagttcctgctgggcccagccttcctggtcagccctgtcctggagcgc
aatgccagaaatgtcactgcatatttccctagagcccgctggtacgattactacacgggt
gtggatattgatgcaagaggagagtggaagaccttgccagcccctcttgactacattaat
cttcatatccgtgggggctacatcctgccctggcaagagcctgcagtgaacacccactta
agtcgaaagaaccctcttggtcttatcattgccctagatgagaacaaagaagcaaaagga
gaacttttctgggatgatgggcaaacgaaggatactgtggccaataaagtgtatctttta
tgtgagttttctgtcactcaaaaccgcttggaggtgaatatttcacaatcaacctacaag
gaccccaataatttagcatttaatgagattaaaattcttgggacggaggaacctagcaat
gttacagtgaaacacaatggtgtcccaagtcagacttctcctacagtcacttatgattct
aacctgaaggttgccattatcacagacatcaatcttctcctgggagaagcatacacagtg
gagtgggatataaagacaagggatgatgaaaaaatagactgttaccctgatgagaatggc
gcttctgcagaaaactgcattgcccgtggctgtatctgggaggcatccaattcttctgga
gtccctttttgctattttgtcaacgatctatactctgtcagtaatgttcaatataattca
catggggccacagctgacatctccttaaagtcttccgtgtatgccaatgccttcccctcc
acacccgtgaacccccttcgcctggatgtcacttaccataagaatgaaatgctgcagttc
aagatttatgatcccaacaacaatcggtatgaagttccagttcctctgaacgtacccatg
gtgccatccggcacccctgagggtcaactctatgatgtcctcattaagaagaatccattt
gggattgaaattcgccgcaggagtacaggcactataatttgggactctcagctccttggc
ttcaccttcaatgacatgtttatccgcatctccacccgccttccctccaagtacctctat
ggctttggggaaactgagcacacatcctataggagagacttggagtggcacacttggggg
atgttctcccgagaccagcccccagggtacaagaagaattcctatggggtccacccctac
tacatggggctggaggaggacggcagtgcccacggagtgttcctgctgaacagcaatgcc
atggacgtgacgttccagcccctgcctgccttgacataccgtaccacagggggagttctg
gacttttatgtgttcttggggccaactccagagcttgtcacccagcagtacacggaggta
ggaagaaatccagttgtttatcaagcacttatacagcacattctggatgccagagcccac
atccattag

DBGET integrated database retrieval system