KEGG   Macaca mulatta (rhesus monkey): 695157Help
Entry
695157            CDS       T01028                                 

Gene name
USP1
Definition
(RefSeq) ubiquitin specific peptidase 1
  KO
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    695157 (USP1)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     695157 (USP1)
Peptidases [BR:mcc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   695157 (USP1)
Ubiquitin system [BR:mcc04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    695157 (USP1)
DNA repair and recombination proteins [BR:mcc03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     695157 (USP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 785 aa AA seqDB search
MPGVIPSESNGLSRGSPSKKNRLSLKFFQKKETKRALDFTDSQENEEKASEYRASEIDQV
VPAAQSSPINCEKRENLLPFVGLNNLGNTCYLNSILQVLYFCPGFKSGVKHLFNVISRKK
EALKDEANQKDKGNCKEDSLASYELICSLQSLIISVEQLQASFLLNPEKYTDELATQPRR
LLNTLRELNPMYEGYLQHDAQEVLQCILGNIQETCQLLKKEEVKNVAELPTKVEEIPHQK
EEMSGINSMEMDSVRHSEDCKEKLPKGNGKRKSDTEFGNMKKKVKVSKEHQSLEENQRQT
RSKRKATSDTLEIPPKIIPKCISENESPRPSQKKSRVKINWLKSATKQPSILSKFCSLGK
ITTNQGAKGQSKENEYDPEEDLGKYENDNTTHACGFESPGNTVTPVNVNEVKPINKGEEQ
IGFELVEKLFQGQLVLRTRCLECESLTERREDFQDISVPVQEDELSKVEESSEISPEPKT
EMKTLRWAISQFASVERIVGEDKYFCENCHHYTEAERSLLFDKMPEVITIHLKCFAASGL
EFDCYGGGLSKINTPLLTPLKLSLEEWSTKPTNDSYGLFAVVMHSGITISSGHYTASVKV
TDLNSLELDKGNFVVDQMCEIGKPEPLNEEEARGVVENYDDEEVSIRVGGNTQPSKVLNK
KNVEAIGLLGGQKSKADYELYNKASNPDKVASTAFAENRNSETNDTNGTHESDRNKESSD
QTGVNISGFENKISYVVQSLKEYEGKWLLFDDSEVKVTEEKDFLNSLSPSTSPTSTPYLL
FYKKL
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgcctggtgtcatacctagtgaaagtaatggactttcaagaggtagcccatcaaagaaa
aacagactttccttaaagttttttcagaaaaaggaaactaagagagctttggatttcaca
gattctcaagaaaatgaagaaaaagcttctgaatatagagcatctgaaattgatcaagtt
gttcctgcagcacagtcttcacctataaactgtgagaagagagaaaacttgttaccattt
gtgggactgaataatctcggcaatacttgctatcttaatagtatacttcaggtattatat
ttttgtcccggttttaaatctggagtaaagcacttatttaatgttatttcaaggaagaaa
gaagctctaaaggatgaagccaatcaaaaagacaagggaaattgcaaagaagattctttg
gcaagttatgaattgatatgcagtttacagtccttaatcatttcggttgaacagctccaa
gctagttttctcttaaatccagagaaatatactgatgaacttgccactcagccaaggcga
ctgcttaacacactcagggaactcaaccctatgtatgaaggctatctacagcatgatgca
caggaagtattacagtgtattttgggaaacattcaagaaacatgccaactcctaaaaaaa
gaagaagtaaaaaatgtggcagaattacctactaaggtagaagaaatacctcatcagaaa
gaggaaatgagtggtattaacagcatggagatggacagtgtgaggcattctgaagactgt
aaagaaaaactcccaaaaggaaatgggaaaagaaaaagtgacactgaatttggtaacatg
aagaaaaaagttaaagtatccaaggaacaccagtcattggaagagaaccagagacaaact
agatcaaaaagaaaagctacaagtgatacattagagattcctcctaaaataattcccaag
tgtatttctgaaaatgagagtccaagaccctcacaaaagaaatcaagagttaaaataaat
tggttaaagtctgcaactaagcaacccagcattctttctaaattctgtagtctgggaaaa
ataacaacaaaccaaggagccaaaggacaatctaaagaaaatgaatatgatcctgaagag
gacttggggaagtatgaaaatgataacacaactcatgcttgtggatttgaatctccagga
aatactgttacacctgtgaatgttaatgaagttaaacccataaacaaaggtgaggaacaa
attggttttgagctagtggagaaattatttcaaggtcagctggtattaaggacgcgttgc
ttggaatgtgaaagtttaacagaaagaagagaagattttcaagacatcagtgtgccagta
caagaagatgagctttccaaagtagaggagagttctgaaatttctccagagccaaaaaca
gaaatgaagaccctgagatgggcaatttcacaatttgcttcagtagaaaggatcgtagga
gaagataaatatttctgtgaaaactgccatcattatactgaagctgaacgaagtcttttg
tttgacaaaatgcctgaagttataactattcatttgaagtgctttgctgctagcggtttg
gagtttgattgttacggtggtggactttccaagatcaacactcctttattgacacctctt
aaattgtcactagaagaatggagcacaaagccaactaacgacagctatggattgtttgcg
gttgtgatgcatagtggcattacaattagtagtgggcattacactgcttctgttaaagtc
actgaccttaacagtttagaactagataaaggaaattttgtggttgaccaaatgtgtgaa
ataggtaagccagaaccattgaatgaggaggaagcaaggggtgtggttgagaattatgat
gatgaagaagtgtcgattagagttggtggaaatacacagccaagtaaagttttgaacaaa
aaaaatgtagaagctattggacttcttggaggacaaaagagcaaagcagattatgagcta
tacaacaaagcctctaatcctgataaggttgctagtacagcgtttgccgaaaatagaaat
tctgagactaacgatactaatgggacccatgaatctgatagaaacaaggaatccagtgac
caaacaggcgttaatattagtggatttgagaacaaaatttcatatgtagtgcaaagctta
aaggagtatgaggggaagtggttgctttttgatgattctgaagtcaaagttactgaagag
aaggactttctgaattctctttccccttctacatctcctacttctactccttacttgcta
ttttataagaaattatag

DBGET integrated database retrieval system