KEGG   Macaca mulatta (rhesus monkey): 695157Help
Entry
695157            CDS       T01028                                 

Gene name
USP1
Definition
ubiquitin specific peptidase 1
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Fanconi anemia pathway
Class
Genetic Information Processing; Replication and repair; Fanconi anemia pathway [PATH:mcc03460]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 794 aa AA seqDB search
MPGVIPSESNGLSRGSPSKKNRLSLKFFQKKETKRALDFTDSQENEEKASEYRASEIDQV
VPAAQSSPINCEKRENLLPFVGLNNLGNTCYLNSILQVLYFCPGFKSGVKHLFNVISRKK
EALKDEANQKDKGNCKEDSLASYELICSLQSLIISVEQLQASFLLNPEKYTDELAXXXXX
XXLATQPRRLLNTLRELNPMYEGYLQHDAQEVLQCILGNIQETCQLLKKEEVKNVAELPT
KVEEIPHQKEEMSGINSMEMDSVRHSEDCKEKLPKGNGKRKSDTEFGNMKKKVKVSKEHQ
SLEENQRQTRSKRKATSDTLEIPPKIIPKCISENESPRPSQKKSRVKINWLKSATKQPSI
LSKFCSLGKITTNQGAKGQSKENEYDPEEDLGKYENDNTTHACGFESPGNTVTPVNVNEV
KPINKGEEQIGFELVEKLFQGQLVLRTRCLECESLTERREDFQDISVPVQEDELSKVEES
SEISPEPKTEMKTLRWAISQFASVERIVGEDKYFCENCHHYTEAERSLLFDKMPEVITIH
LKCFAASGLEFDCYGGGLSKINTPLLTPLKLSLEEWSTKPTNDSYGLFAVVMHSGITISS
GHYTASVKVTDLNSLELDKGNFVVDQMCEIGKPEPLNEEEARGVVENYDDEEVSIRVGGN
TQPSKVLNKKNVEAIGLLGGQKSKADYELYNKASNPDKVASTAFAENRNSETNDTNGTHE
SDRNKESSDQTGVNISGFENKISYVVQSLKEYEGKWLLFDDSEVKVTEEKDFLNSLSPST
SPTSTPYLLFYKKL
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atgcctggtgtcatacctagtgaaagtaatggactttcaagaggtagcccatcaaagaaa
aacagactttccttaaagttttttcagaaaaaggaaactaagagagctttggatttcaca
gattctcaagaaaatgaagaaaaagcttctgaatatagagcatctgaaattgatcaagtt
gttcctgcagcacagtcttcacctataaactgtgagaagagagaaaacttgttaccattt
gtgggactgaataatctcggcaatacttgctatcttaatagtatacttcaggtattatat
ttttgtcccggttttaaatctggagtaaagcacttatttaatgttatttcaaggaagaaa
gaagctctaaaggatgaagccaatcaaaaagacaagggaaattgcaaagaagattctttg
gcaagttatgaattgatatgcagtttacagtccttaatcatttcggttgaacagctccaa
gctagttttctcttaaatccagagaaatatactgatgaacttgcnnnnnnnnnnnnnnnn
nnnnaacttgccactcagccaaggcgactgcttaacacactcagggaactcaaccctatg
tatgaaggctatctacagcatgatgcacaggaagtattacagtgtattttgggaaacatt
caagaaacatgccaactcctaaaaaaagaagaagtaaaaaatgtggcagaattacctact
aaggtagaagaaatacctcatcagaaagaggaaatgagtggtattaacagcatggagatg
gacagtgtgaggcattctgaagactgtaaagaaaaactcccaaaaggaaatgggaaaaga
aaaagtgacactgaatttggtaacatgaagaaaaaagttaaagtatccaaggaacaccag
tcattggaagagaaccagagacaaactagatcaaaaagaaaagctacaagtgatacatta
gagattcctcctaaaataattcccaagtgtatttctgaaaatgagagtccaagaccctca
caaaagaaatcaagagttaaaataaattggttaaagtctgcaactaagcaacccagcatt
ctttctaaattctgtagtctgggaaaaataacaacaaaccaaggagccaaaggacaatct
aaagaaaatgaatatgatcctgaagaggacttggggaagtatgaaaatgataacacaact
catgcttgtggatttgaatctccaggaaatactgttacacctgtgaatgttaatgaagtt
aaacccataaacaaaggtgaggaacaaattggttttgagctagtggagaaattatttcaa
ggtcagctggtattaaggacgcgttgcttggaatgtgaaagtttaacagaaagaagagaa
gattttcaagacatcagtgtgccagtacaagaagatgagctttccaaagtagaggagagt
tctgaaatttctccagagccaaaaacagaaatgaagaccctgagatgggcaatttcacaa
tttgcttcagtagaaaggatcgtaggagaagataaatatttctgtgaaaactgccatcat
tatactgaagctgaacgaagtcttttgtttgacaaaatgcctgaagttataactattcat
ttgaagtgctttgctgctagcggtttggagtttgattgttacggtggtggactttccaag
atcaacactcctttattgacacctcttaaattgtcactagaagaatggagcacaaagcca
actaacgacagctatggattgtttgcggttgtgatgcatagtggcattacaattagtagt
gggcattacactgcttctgttaaagtcactgaccttaacagtttagaactagataaagga
aattttgtggttgaccaaatgtgtgaaataggtaagccagaaccattgaatgaggaggaa
gcaaggggtgtggttgagaattatgatgatgaagaagtgtcgattagagttggtggaaat
acacagccaagtaaagttttgaacaaaaaaaatgtagaagctattggacttcttggagga
caaaagagcaaagcagattatgagctatacaacaaagcctctaatcctgataaggttgct
agtacagcgtttgccgaaaatagaaattctgagactaacgatactaatgggacccatgaa
tctgatagaaacaaggaatccagtgaccaaacaggcgttaatattagtggatttgagaac
aaaatttcatatgtagtgcaaagcttaaaggagtatgaggggaagtggttgctttttgat
gattctgaagtcaaagttactgaagagaaggactttctgaattctctttccccttctaca
tctcctacttctactccttacttgctattttataagaaattatag

DBGET integrated database retrieval system