KEGG   Macaca mulatta (rhesus monkey): 695235Help
Entry
695235            CDS       T01028                                 

Gene name
USP17L2
Definition
ubiquitin specific peptidase 17-like family member 2
Orthology
K11845  
ubiquitin carboxyl-terminal hydrolase 17 [EC:3.1.2.15]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     695235 (USP17L2)
Peptidases [BR:mcc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   695235 (USP17L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 529 aa AA seqDB search
MEADSLHLGGEWQFNHFSKLTSSGPDAAFAEIQRTSLTEKSPLSSETHVNFCDGLAPVAR
QPAPGEKLPLSSRRPAAVGAGLQNMGDTCYVNASLQCLTYTPPLANYMLSREHSQLCHCH
KSCMLCTMEAHITWALHCPGHVIQPSQTLAAGFHRGKQEDAHEFLMFIVDAMKKACLPGH
KQVDHDSEDTTLIHQIFGGCWRSQIKCLHCQGVSDTFDPYLDIALDIRAAQSVKQALEQV
VKPEELNGENAYHCGLCLQKAPASKTFTLHTSAKVLILVLKRFSDVTGNKLAKNVQYPEC
LDMQPYMSQQNTGPLVYVLYAVLVHAGWSCHNGHYLSFVKAPGGQWYKMDDAKVTACSIA
SVLSQQAYVLFYIQKSQLERCSESVSMGREPGALGAEHKDRRAMQGELQREPCLQVPDLE
EHLVERATQESTLDHWKLLQEQNKTKPDFNVRRVECTLPPNVLVIHPSKYKSGMNNRHPE
QQSSLLNLSSRNLTPQESMNTGTLTSLQGRTRRSKGRNKHSKRALFVCQ
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgattcactccacttgggaggtgagtggcagttcaaccacttttcaaaactc
acatcttctgggccagatgcagcttttgctgaaatccagcggacttctctaactgagaag
tcaccactgtcatctgagacccatgtcaacttctgtgatggtttggctcctgtggcaaga
cagcctgcccctggggagaagcttcctctcagtagcaggagacctgctgcggtgggggct
gggctccagaatatgggagatacttgctacgtgaatgcttccctgcagtgcctgacatac
acaccaccccttgccaactacatgctgtcccgggagcactctcaactttgtcattgtcac
aagtcctgcatgctgtgtacgatggaagctcacatcacatgggccctccactgtcctggc
cacgtcatccagccttcacagacattggctgctggcttccatcgaggcaagcaggaagac
gcccatgaatttctgatgttcattgtggatgccatgaaaaaggcatgccttcccgggcac
aagcaggtagatcatgactctgaggacaccaccctcatccaccagatatttggaggctgc
tggagatctcaaatcaagtgtctccactgccagggcgtttcagacacctttgacccttac
ctggacatcgccctggatatcagggcagctcagagtgtgaagcaagctttggaacaggtg
gtgaagcccgaagaactcaatggagagaatgcctatcattgtggtctttgtctccagaag
gcgcctgcctccaagacgttcactctacacacttctgccaaggtcctcatccttgtattg
aagagattctccgatgtcacaggcaacaaacttgccaagaatgtgcaataccctgagtgc
cttgacatgcagccatacatgtctcagcagaacacaggacctcttgtctatgtcctctat
gctgtgctggtccacgctgggtggagttgtcacaatggacattacctctcttttgtcaaa
gctccaggaggccagtggtataaaatggatgacgccaaggtcactgcctgtagcatcgct
tctgtcctgagccaacaggcttatgtcctcttttacatccagaagagtcaactggaaaga
tgcagtgagagtgtgtcaatgggcagggaaccaggagcccttggcgctgaacacaaagac
aggcgagcaatgcaaggagagctccagagagaaccctgcctccaggtacccgacttggag
gagcacttggtggaaagagccactcaggaaagcaccttagaccactggaagctcctccaa
gagcaaaacaaaaccaagcctgacttcaacgtcagaagagtcgaatgtaccctgcctccc
aacgtgcttgtgattcatccatcaaaatacaagagtgggatgaacaaccgtcatcctgaa
cagcaaagctccctgctgaacctctcttcaaggaacctgacacctcaggagtccatgaac
actggcacactcacttctctgcaagggaggaccaggagatccaaagggaggaacaaacac
agcaagagggctctgtttgtgtgccagtga

DBGET integrated database retrieval system