KEGG   Macaca mulatta (rhesus monkey): 695235Help
Entry
695235            CDS       T01028                                 

Gene name
USP17L2
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 17
  KO
K11845  
ubiquitin carboxyl-terminal hydrolase 17 [EC:3.4.19.12]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     695235 (USP17L2)
Peptidases [BR:mcc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   695235 (USP17L2)
Ubiquitin system [BR:mcc04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    695235 (USP17L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 529 aa AA seqDB search
MEADSLHLGGEWQFNHFSKLISSRPDAAFAEIQQTSLPEKSPLSSETQVNLCDDLAPVAR
QPAPRKKLPLSSRRPAAVGAGLQNMGNTCYLNASLQCLTYTPPLANYMLSQEHSQLCQRH
KCCMLCTMEAHITWALHCPGHVTQPSQALAAGFHRGKQEDAHEFLMFIVDAMKKACLPGH
KQVDHDSEDTTLIHQIFGGCWRSQIKCLHCQGVSDTFDPYLDIALDIQAAQSVKQALEQV
VKPEELNGENAYHCGLCLQKAPASKTFTLHTSAKVLILVLKRFSDVTGNKLAKNVQYPEC
LDMQPYMSQQNTGPLVYVLYAVLVHAGWSCHNGHYLSYVKAPGGQWYKMDDAEVTACSIA
SVLSQQAYVLFYIQKSELERCSESVSIGREPGALGAEHKDRRATQGELQREPCLQVPDLE
EHLVERATQESTLDHWKFLQEQNKTKPDFNVRKVECTLPPNVLVIHPSKYKSGMNNRHPE
QQSSLLNLSSRNLTPQESMNTDTLTSLQGRTRRSKGRNKHSKRALFVCQ
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgattcactccacttgggaggtgagtggcagttcaaccacttttcaaaactc
atatcttctcggccagatgcagcttttgctgaaattcagcagacttctctacctgagaag
tcaccactgtcatctgagacccaagtcaacctctgtgatgatttggctcctgtggcaaga
cagcctgcccccagaaagaagcttcctctcagtagcaggagacctgctgcggtgggggct
gggctccagaatatgggaaatacttgctacttgaatgcttccctgcagtgcctgacatac
acaccgccccttgccaactacatgctgtcccaggagcactctcaactttgtcagcgtcac
aagtgctgcatgctgtgtacgatggaagctcacattacatgggccctccactgtcctggc
catgtcacccagccctcacaggcattggctgctggcttccatcgaggcaagcaggaagat
gcccatgagtttctgatgttcattgtggatgccatgaaaaaggcatgccttcccgggcac
aagcaggtagatcatgactctgaggacaccaccctcatccaccagatatttggaggctgc
tggagatctcaaatcaagtgtctccactgccagggcgtttcggacacctttgacccttac
ctggacatcgccctggatatccaggcagctcagagtgtgaagcaagctttggagcaggtg
gtgaagcccgaagaactcaatggagagaatgcctatcattgtggtctttgtctccagaag
gcgcctgcctccaagacgttcactctacacacttctgccaaggtcctcatccttgtattg
aagagattctccgatgtcacaggcaacaaacttgccaagaatgtgcaataccctgagtgc
cttgacatgcagccatacatgtctcagcagaacacgggacctctagtctatgtcctctat
gctgtgctggtccacgctgggtggagttgtcacaacggacattacctctcttatgtcaaa
gctccaggaggccagtggtataaaatggatgacgccgaggtcactgcctgtagcatcgct
tctgtcctgagtcaacaggcctatgtcctcttttacatccagaagagtgaactggaaaga
tgcagtgagagtgtgtcaataggcagggaaccaggagcccttggcgctgaacacaaagac
aggcgagcaacgcaaggagagctccagagagaaccctgcctccaggtacctgacttggag
gagcacttggtggaaagagccactcaggaaagcaccttagaccactggaagttcctccaa
gagcaaaacaaaaccaagcctgacttcaacgtcagaaaagtcgaatgtaccctgcctccc
aacgtgcttgtgattcatccatcaaaatacaagagtgggatgaacaaccgtcatcctgaa
cagcaaagctccctgctgaacctctcttcaaggaacctgacacctcaggagtccatgaac
actgacacactcacttctctgcaagggaggaccaggagatccaaagggaggaacaaacac
agcaagagggctctgtttgtgtgccagtga

DBGET integrated database retrieval system