KEGG   Macaca mulatta (rhesus monkey): 695272Help
Entry
695272            CDS       T01028                                 

Gene name
GUK1
Definition
guanylate kinase 1
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    695272 (GUK1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     695272 (GUK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 218 aa AA seqDB search
MLRRPLAGLAAAALGRAPPDGMSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHT
TRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKAAVQAVQAMNRICV
LDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLAKRLAAARADMESS
KEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggcgcccgctggccgggctggctgcggccgccctgggccgggccccaccggac
ggcatgtcaggccccaggcctgtggtgctgagtgggccttcgggagctgggaagagcacc
ctgctgaagaggctgctccaggagcacagcggcatctttggcttcagcgtgtcccatacc
acaaggaacccgaggcctggcgaggagaatggcaaagattactactttgtaaccagggag
gtgatgcagcgtgacatagcagccggtgacttcattgagcatgccgagttctcagggaac
ctgtatggcacgagcaaggcggcggtgcaggccgtgcaggccatgaaccgcatctgcgtg
ctggacgtggacctgcagggtgtgcggaacatcaaggccaccgatctgcggcccatctac
atctctgtgcagccgccctcactgcatgtgctggagcagcggctgcggcagcgcaacact
gaaacggaggagagcctggcgaagcggctggctgctgcccgggccgacatggagagcagc
aaggagcccggcctttttgatgtggtcatcatcaacgacagtctggaccaggcctacgcg
gagctgaaggaggcgctctctgaggaaatcaagaaagctcaaaggaccggcgcctga

DBGET integrated database retrieval system