KEGG   Macaca mulatta (rhesus monkey): 695272Help
Entry
695272            CDS       T01028                                 

Gene name
GUK1
Definition
(RefSeq) guanylate kinase 1
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00230  Purine metabolism
mcc01100  Metabolic pathways
Module
mcc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    695272 (GUK1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     695272 (GUK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 AAA_16 MMR_HSR1 ABC_tran RsgA_GTPase AAA_22 NACHT cobW AAA_30 AAA_29 AAA_28 AAA_24 dNK AAA_14 RNA_helicase Zeta_toxin DUF2075 NTPase_1 AAA_17 AAA_5 AAA ATPase_2 TsaE Dynamin_N Viral_helicase1 Rad17 Roc AAA_23
Motif
Other DBs
NCBI-GeneID: 695272
NCBI-ProteinID: NP_001253679
Ensembl: ENSMMUG00000023085
UniProt: I2CWX1
Position
1
AA seq 218 aa AA seqDB search
MLRRPLAGLAAAALGRAPPDGMSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHT
TRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKAAVQAVQAMNRICV
LDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLAKRLAAARADMESS
KEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggcgcccgctggccgggctggctgcggccgccctgggccgggccccaccggac
ggcatgtcaggccccaggcctgtggtgctgagtgggccttcgggagctgggaagagcacc
ctgctgaagaggctgctccaggagcacagcggcatctttggcttcagcgtgtcccatacc
acaaggaacccgaggcctggcgaggagaatggcaaagattactactttgtaaccagggag
gtgatgcagcgtgacatagcagccggtgacttcattgagcatgccgagttctcagggaac
ctgtatggcacgagcaaggcggcggtgcaggccgtgcaggccatgaaccgcatctgcgtg
ctggacgtggacctgcagggtgtgcggaacatcaaggccaccgatctgcggcccatctac
atctctgtgcagccgccctcactgcatgtgctggagcagcggctgcggcagcgcaacact
gaaacggaggagagcctggcgaagcggctggctgctgcccgggccgacatggagagcagc
aaggagcccggcctttttgatgtggtcatcatcaacgacagtctggaccaggcctacgcg
gagctgaaggaggcgctctctgaggaaatcaagaaagctcaaaggaccggcgcctga

DBGET integrated database retrieval system