KEGG   Macaca mulatta (rhesus monkey): 695558Help
Entry
695558            CDS       T01028                                 

Gene name
PRKAA1
Definition
(RefSeq) protein kinase, AMP-activated, alpha 1 catalytic subunit
  KO
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Longevity regulating pathway - multiple species
Circadian rhythm
Insulin signaling pathway
Adipocytokine signaling pathway
Oxytocin signaling pathway
Glucagon signaling pathway
Insulin resistance
Non-alcoholic fatty liver disease (NAFLD)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    695558 (PRKAA1)
   04151 PI3K-Akt signaling pathway
    695558 (PRKAA1)
   04152 AMPK signaling pathway
    695558 (PRKAA1)
   04150 mTOR signaling pathway
    695558 (PRKAA1)
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    695558 (PRKAA1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    695558 (PRKAA1)
   04922 Glucagon signaling pathway
    695558 (PRKAA1)
   04920 Adipocytokine signaling pathway
    695558 (PRKAA1)
   04921 Oxytocin signaling pathway
    695558 (PRKAA1)
  Aging
   04211 Longevity regulating pathway - mammal
    695558 (PRKAA1)
   04213 Longevity regulating pathway - multiple species
    695558 (PRKAA1)
  Environmental adaptation
   04710 Circadian rhythm
    695558 (PRKAA1)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    695558 (PRKAA1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    695558 (PRKAA1)
   04931 Insulin resistance
    695558 (PRKAA1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     695558 (PRKAA1)
Protein kinases [BR:mcc01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   695558 (PRKAA1)
Mitochondrial biogenesis [BR:mcc03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    695558 (PRKAA1)
  Mitophagy factors
   Other mitophagy factors
    695558 (PRKAA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 559 aa AA seqDB search
MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNR
QKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNG
RLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEF
LRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDG
IFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID
DEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDS
FLDDHHLSRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDI
MAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDE
ITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPG
SHTIEFFEMCANLIKILAQ
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagactcagttcctggagaaagatggcgacagccgagaagcagaaacacgacggg
cgggtgaagatcggccactacatcctgggtgacacgctgggggtcggcaccttcggcaaa
gtgaaggttggcaaacatgaattgactgggcataaagttgctgtgaagatactcaatcga
cagaagattcggagccttgatgtggtaggaaaaatccgcagagaaattcagaacctcaag
cttttcaggcatcctcatataattaaactgtaccaggtcatcagtacaccatctgatatt
ttcatggtgatggaatatgtctcaggaggagagctatttgattatatctgtaagaatgga
aggctggatgaaaaagaaagtcgacgtctattccaacagatcctttctggtgtggattat
tgtcacaggcatatggtagtccatagagatttgaaacctgaaaatgtcctgcttgatgca
cacatgaatgcaaagatagccgattttggtctttcaaacatgatgtcagatggtgaattt
ttaagaacaagttgtggctcacccaactatgctgcaccagaagtaatttcaggaagattg
tatgcaggcccagaggtagatatatggagcagtggggttattctctatgctttattatgt
ggaacccttccatttgatgatgaccatgtgccaactctttttaagaagatatgtgatggg
atcttctatacccctcaatatttaaatccttctgtgattagccttttgaaacatatgctg
caggtggatcccatgaagagggccacaatcaaagatatcagggaacatgaatggtttaaa
caggaccttccaaagtatctctttcctgaggatccatcatatagttcaaccatgattgac
gatgaagccttaaaagaagtatgtgaaaagtttgagtgctcagaagaggaagttctcagc
tgtctttataacagaaatcaccaggatcctttggcagttgcataccatctcataatagat
aacaggagaataatgaatgaagccaaagatttctatttggcgacaagcccacctgattct
tttcttgatgatcatcacctgtctcggccccatcctgaaagagtaccattcttggttgct
gaaacaccaagggcacgccatacccttgatgaattaaatccgcagaaatccaaacaccaa
ggtgtaaggaaagcaaaatggcatttaggaattagaagtcaaagtcgtccaaatgatatt
atggcagaagtatgtagagcaattaaacaattggattatgaatggaaggttgtaaaccca
tattatttgcgtgtacgaaggaagaatcctgtgacaagcacttactcgaaaatgagtcta
cagttataccaggtggatagtagaacttatctactggatttccgtagtattgatgatgaa
attacagaagccaaatcagggactgctactccacagagatcgggatcagttagcaactat
cgatcttgccaaaggagtgattcagatgctgaggctcaaggaaaatcctcagaagtttct
cttacctcatctgtgacctcacttgactcttctcctgttgacctaactccaagacctgga
agtcacacaatagaattttttgagatgtgtgcaaatctaattaaaattcttgcacaataa

DBGET integrated database retrieval system