KEGG   Macaca mulatta (rhesus monkey): 695652Help
Entry
695652            CDS       T01028                                 

Gene name
CYLD
Definition
cylindromatosis (turban tumor syndrome)
Orthology
K08601  
ubiquitin thioesterase CYLD [EC:3.4.19.12]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Osteoclast differentiation
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    695652 (CYLD)
  Development
   04380 Osteoclast differentiation
    695652 (CYLD)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     695652 (CYLD)
Peptidases [BR:mcc01002]
 Cysteine Peptidases
  Family C67
   695652 (CYLD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
20
AA seq 919 aa AA seqDB search
MSSGLWSQEKVTSPYWEERIFYLLLQECSVTDKQTQKLLKVPKGSIGQYIQDRSVGHSRI
PSAKGKKNQIGLKILEQPHAVLFVDEKDVAEINEKFTELLLAITNCEERFSLFKNRNRLS
KGLQIDVGCPVKVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGV
YQGKQLFQCDEDCGVFVALDKLELIEDDDTALESDYAGPVDTMQVELPPLEINSRVSLKV
GETIESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRFDGVQLCSFACVESTILLHIN
DIIPESVSQERRPPKLAFMSRGVGDKGSSSHNKPKATGSTSDPGNRNRSELFYTLNGSSV
DSQPQSKSKNTWYIDEVAEDPAKSLTEISTDFDRSSPPLQPPPVNSLSTENRFHSLPFSL
TKMPNTNGSIGHSPLSLSAQSVMEELNTAPVQESPPLAMPPGNSHGLEVGSLAEVKENPP
FYGVIRWIGQPPGLNEVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRPDS
RFASLQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNSCYL
DSTLFCLFAFSSVLDTVLLRPKEKNDVEYYSETQELLRTEIVNPLRIYGYVCATKIMKLR
KILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLLKISTIVYLKIKSNAPSCLIIQMP
RFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECYDDPDISAGKIKQFC
KTCNTQVHLHPKRLNHKYNPVSLPKDLPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVK
YGKDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARR
LLCDAYMCMYQSPTMSLYK
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaggcttatggagccaagaaaaagttacttcgccctactgggaagagcggatt
ttttatttgcttcttcaagaatgcagcgttacagacaaacaaacacaaaagctccttaaa
gtaccgaagggaagtataggacagtatattcaagatcgttctgtggggcattcaaggatt
ccttctgcaaaaggcaagaaaaatcagattggattaaaaattctagagcaacctcatgca
gttctctttgttgatgaaaaggatgttgcagagataaatgaaaagttcacagagttactt
ttggcaattaccaattgtgaggagaggttcagcctgtttaaaaacagaaacagactaagt
aaaggcctccaaatagacgtgggctgccctgtgaaagtacagttgagatctggggaagaa
aaatttcctggagttgtgcgcttcagaggaccactgttagcagagaggacagtctctgga
atattctttggagttgaattgctggaagaaggtcgtggccaaggtttcactgacggggtg
taccaagggaaacagctttttcagtgtgatgaagactgtggcgtgtttgttgcattggac
aagctagaactcatagaagatgatgacactgcgttggaaagtgattatgcaggtcctgtg
gacacaatgcaggtcgagcttcctcctttggaaataaactccagagtttctttgaaggtt
ggagaaacaatagaatctggaacagttatattctgtgatgttttgccaggaaaagaaagc
ttaggatattttgttggtgtggacatggataaccctattggcaactgggatggaagattc
gacggagtgcagctttgcagttttgcgtgtgttgaaagtacaattctgttgcacatcaat
gatatcatcccagagagcgtgtcacaggaaaggaggcctcccaaacttgcctttatgtca
agaggtgttggggacaaaggttcgtccagtcataataaaccaaaggcgacaggatctacc
tcagaccctggaaatagaaacagatctgaattattttataccttaaatgggtcttctgtt
gactcacaaccacaatccaaatcaaaaaatacatggtacattgatgaagttgcagaagac
cctgcaaaatctcttacagagatatctacagactttgaccgttcttcaccaccactccag
cctcctcctgtgaactcactgtccaccgagaacagattccactctttaccgttcagtctc
acaaagatgcctaataccaatggaagtattggccacagtccactttctctgtcagcccag
tctgtgatggaagagctaaacactgcacccgtgcaagagagtccacccttggctatgcct
cctgggaactcacatggtctagaagtgggctcactggctgaagttaaggagaaccctcct
ttctacggggtaatccgttggatcggtcagcccccaggactgaatgaagtacttgctgga
ctggaactggaagatgagtgtgcaggctgtacggatggaaccttcagaggcactcggtat
ttcacctgtgccctgaagaaggcgctgtttgtgaaactgaagagctgcaggcctgactct
aggtttgcatcattgcagccggtttccaatcagatcgagcgctgtaactccttagcattt
ggaggctacttaagtgaagtagtagaagaaaatactccaccaaaaatggaaaaagaaggc
ttggagataatgattgggaagaagaaaggcattcagggtcattacaattcttgttactta
gactcaaccttattctgcttatttgcttttagttctgttctggacactgtgttacttaga
cccaaagaaaagaatgatgtagaatattatagtgaaacccaagagttactgaggacagaa
attgttaatcctctgagaatatatggatatgtgtgtgccacaaaaattatgaaactgagg
aaaatacttgaaaaggtggaggctgcatcaggatttacctctgaagaaaaagatcctgag
gaattcttgaatatcctgtttcatcatattttaagggtagaacctttgctaaaaataagt
accatagtttacttgaagatcaaatccaatgcaccatcatgtctgattattcagatgcct
cgatttggaaaagactttaaactatttaaaaaaatttttccttctctggaattaaatata
accgatttacttgaagacactcccagacagtgccggatatgtggagggcttgcaatgtat
gagtgtagagaatgctacgacgatccggacatctcagctggaaaaatcaagcagttttgt
aaaacctgcaacactcaagtccaccttcatcccaagaggctgaatcataaatataaccca
gtgtcacttcccaaagacttacctgactgggactggagacacggctgcatcccttgccag
aagatggagttatttgctgttctctgcatagaaacaagccactatgttgcttttgtgaag
tatgggaaggacgactccgcctggctcttctttgacagcatggccgatcgggatggtggt
cagaacggcttcaacattcctcaagtcaccccatgcccagaagtaggagagtacttgaag
atgtctctggaagacctgcattccttggactccagaagaatccaaggctgtgcgcgaaga
ctgctttgtgatgcgtatatgtgcatgtaccagagtccaacaatgagtttgtacaaataa

DBGET integrated database retrieval system