KEGG   Macaca mulatta (rhesus monkey): 695675Help
Entry
695675            CDS       T01028                                 

Gene name
GCH1
Definition
GTP cyclohydrolase 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    695675 (GCH1)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     695675 (GCH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 213 aa AA seqDB search
MEKGPVRVPAEKPRGARCSNGFSERDPPRPGPSRPAEKTPRPEAKSAQPADGWKGERPRS
EEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDA
IFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQ
VQERLTKQIAVAITEALRPAGVGVVVEATSAEP
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggagaagggccctgtgcgggtcccggcggagaagccgcggggcgccaggtgcagcaat
gggttctccgagcgggatccgccgcggcccgggcccagcaggccggcggagaagaccccg
cggcccgaggccaagagcgcgcagcccgcggacggctggaagggcgagcgaccccgcagc
gaggaggataacgagctgaacctccccaacctggcagccgcctactcgtccatcctgagc
tcgctgggcgagaacccccagcggcaagggctgctcaagacaccctggagggcggcctcg
gccatgcaattcttcaccaagggctaccaggagacaatctcagatgtcctaaacgatgct
atatttgatgaagatcatgatgagatggtgatcgtgaaggacatagacatgttttccatg
tgtgagcatcacttggttccatttgttggaaaggtccatattggttatcttcctaacaag
caagtccttggcctcagcaaacttgcaaggattgtagaaatctatagtagaagactacaa
gttcaggagcgccttacgaaacaaattgctgtagcaatcacagaagccttgcggcctgct
ggagtcggggtagtggttgaagcaacgtctgcagaaccatag

DBGET integrated database retrieval system