KEGG   Macaca mulatta (rhesus monkey): 695675Help
Entry
695675            CDS       T01028                                 

Gene name
GCH1
Definition
(RefSeq) GTP cyclohydrolase 1
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00790  Folate biosynthesis
mcc01100  Metabolic pathways
Module
mcc_M00842  Tetrahydrobiopterin biosynthesis, GTP => BH4
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    695675 (GCH1)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     695675 (GCH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_cyclohydroI QueF MAPKK1_Int
Motif
Other DBs
NCBI-GeneID: 695675
NCBI-ProteinID: XP_001087365
Ensembl: ENSMMUG00000004084
UniProt: F6ZD25
Position
7
AA seq 250 aa AA seqDB search
MEKGPVRVPAEKPRGARCSNGFSERDPPRPGPSRPAEKTPRPEAKSAQPADGWKGERPRS
EEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDA
IFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQ
VQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKT
REEFLTLIRS
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggagaagggccctgtgcgggtcccggcggagaagccgcggggcgccaggtgcagcaat
gggttctccgagcgggatccgccgcggcccgggcccagcaggccggcggagaagaccccg
cggcccgaggccaagagcgcgcagcccgcggacggctggaagggcgagcgaccccgcagc
gaggaggataacgagctgaacctccccaacctggcagccgcctactcgtccatcctgagc
tcgctgggcgagaacccccagcggcaagggctgctcaagacaccctggagggcggcctcg
gccatgcaattcttcaccaagggctaccaggagacaatctcagatgtcctaaacgatgct
atatttgatgaagatcatgatgagatggtgatcgtgaaggacatagacatgttttccatg
tgtgagcatcacttggttccatttgttggaaaggtccatattggttatcttcctaacaag
caagtccttggcctcagcaaacttgcaaggattgtagaaatctatagtagaagactacaa
gttcaggagcgccttacgaaacaaattgctgtagcaatcacagaagccttgcggcctgct
ggagtcggggtagtggttgaagcaacacacatgtgtatggtaatgcgaggtgtacagaaa
atgaacagcaaaactgtgaccagcacgatgttgggtgtgttccgggaggatccaaagact
cgggaagagttcctgactctcattaggagctga

DBGET integrated database retrieval system