KEGG   Macaca mulatta (rhesus monkey): 695799Help
Entry
695799            CDS       T01028                                 

Definition
(RefSeq) phosphoglycerate mutase 1 (brain)-like
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Glucagon signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    695799
   01230 Biosynthesis of amino acids
    695799
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    695799
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    695799
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    695799
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    695799
Enzymes [BR:mcc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     695799
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   695799
  Exosomal proteins of melanoma cells
   695799
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 136 aa AA seqDB search
MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQ
KRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYD
VPPPPMEPDHPFYSNI
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctacaagctggtgctgatccggcacggcgagagcgcatggaacctggagaac
cgcttcagcggctggtacgacgccgacctgagcccagcgggccacgaggaggcgaagcgc
ggcgggcaggcgctgcgagatgctggctatgagtttgacatctgcttcacctcagtacag
aagagagcgatccggaccctctggacagtgctagatgccattgatcagatgtggctgcca
gtggtgaggacttggcgcctcaatgagcggcactatgggggtctaaccggtctcaataaa
gcagaaactgctgcaaagcatggtgaggcccaggtgaagatctggaggcgctcctatgat
gtcccaccacctccgatggagcccgaccaccctttctacagcaacatc

DBGET integrated database retrieval system