KEGG   Macaca mulatta (rhesus monkey): 695799Help
Entry
695799            CDS       T01028                                 

Gene name
PGAM1
Definition
phosphoglycerate mutase 1 (brain)-like
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    695799 (PGAM1)
   01230 Biosynthesis of amino acids
    695799 (PGAM1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    695799 (PGAM1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    695799 (PGAM1)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    695799 (PGAM1)
Enzymes [BR:mcc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     695799 (PGAM1)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   695799 (PGAM1)
  Exosomal proteins of melanoma cells
   695799 (PGAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 229 aa AA seqDB search
MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQ
KRAIRTLWTVLDAIDQMWLPVHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADL
TEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAI
MELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctacaagctggtgctgatccggcacggcgagagcgcatggaacctggagaac
cgcttcagcggctggtacgacgccgacctgagcccagcgggccacgaggaggcgaagcgc
ggcgggcaggcgctgcgagatgctggctatgagtttgacatctgcttcacctcagtacag
aagagagcgatccggaccctctggacagtgctagatgccattgatcagatgtggctgcca
gtgcatggtgaggcccaggtgaagatctggaggcgctcctatgatgtcccaccacctccg
atggagcccgaccaccctttctacagcaacatcagtaaggatcgcaggtatgcagacctc
acagaagatcagctaccctcctgtgagagtctgaaggacactattgccagagctctgccc
ttctggaatgaagaaatagttccccagatcaaggaggggaaacgtgtactgattgcagcc
catggcaacagcctccggggcattgtcaagcatctggagggtctctctgaagaggctatc
atggagctgaacctgccgactggtattcccattgtctatgaattggacaagaacttgaag
cctatcaagcccatgcagttcctgggggatgaagagacggtgcgcaaagccatggaagct
gtggccgcccagggcaaggccaagaagtga

DBGET integrated database retrieval system