KEGG   Macaca mulatta (rhesus monkey): 695933Help
Entry
695933            CDS       T01028                                 

Definition
histone acetyltransferase type B catalytic subunit-like
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Alcoholism
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Human Diseases
  Substance dependence
   05034 Alcoholism
    695933
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     695933
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 419 aa AA seqDB search
MAGFGAMEKFLVEYKSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLF
GDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFC
TNTNDFLSLLEKEVDFKPFGTLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQT
FLMWFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQ
MLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCF
SREKLMQGFNEDMAIEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLI
SPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFRNXSGDYRRVIERLAQE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcgggatttggtgctatggagaaatttttggtagaatataagagtgcagtggagaag
aaactggcagagtacaaatgtaacaccaacacagcaattgaactaaaattagttcgtttt
cctgaagatcttgaaaatgacattagaactttctttcctgagtatacccatcaactcttt
ggggatgatgaaactgcttttggttacaagggtctgaagatcctgttatactatattgct
ggtagcctgtcaacaatgttccgtgttgaatatgcatctaaagttgatgagaactttgac
tgtgtagaggcagatgatgttgagggcaaaattagacaaatcattccacctggattttgc
acaaacacaaatgatttcctttctttactggaaaaagaagttgatttcaagccattcgga
accttacttcatacctactcagttctcagtccaacaggaggagaaaactttacctttcag
atatataaggccgacatgacatgtagaggctttcgagagtatcatgaaaggcttcagacc
tttttgatgtggtttattgaaactgctagctttattgacgtggatgatgaaagatggcac
tactttctagtatttgagaagtataataaggatggagctacgctctttgcgaccgtaggc
tacatgacagtctataattactatgtgtacccagacaaaacccggccacgtgtaagtcag
atgctgattttgactccatttcaaggtcaaggccatggtgctcagcttcttgaaacagtt
catagatactacactgaatttcctacagttcttgatattacagcggaagatccatccaaa
agctatgtgaaattacgagactttgtgcttgtgaagctttgtcaagatttgccctgtttt
tcccgggaaaaattaatgcaaggattcaatgaagatatggcaatagaggcacaacagaag
ttcaaaataaacaagcaacatgctagaagggtttatgaaattcttcgactactagtaact
gacatgagtgatgccgaacaatacagaagctatagactggatattaaaagaagactaatt
agcccatataagaaaaagcagagagatcttgctaagatgagaaaatgtctcagaccagaa
gaactgacaaaccagatgaaccaaatagaaataagcatgcaacatgaacagctggaagag
agtttcaggaacnntagtggagattaccggcgtgttattgagcgactcgctcaagagtaa

DBGET integrated database retrieval system