KEGG   Macaca mulatta (rhesus monkey): 696308Help
Entry
696308            CDS       T01028                                 

Gene name
PRKG2
Definition
(RefSeq) protein kinase, cGMP-dependent, type II
  KO
K19477  
cGMP-dependent protein kinase 2 [EC:2.7.11.12]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
cGMP-PKG signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Long-term depression
Olfactory transduction
Regulation of lipolysis in adipocytes
Renin secretion
Salivary secretion
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    696308 (PRKG2)
 Cellular Processes
  Cellular community
   04540 Gap junction
    696308 (PRKG2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    696308 (PRKG2)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    696308 (PRKG2)
   04924 Renin secretion
    696308 (PRKG2)
  Digestive system
   04970 Salivary secretion
    696308 (PRKG2)
  Nervous system
   04730 Long-term depression
    696308 (PRKG2)
  Sensory system
   04740 Olfactory transduction
    696308 (PRKG2)
  Environmental adaptation
   04713 Circadian entrainment
    696308 (PRKG2)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     696308 (PRKG2)
Protein kinases [BR:mcc01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   696308 (PRKG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
5
AA seq 583 aa AA seqDB search
MVECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYN
CTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKII
DCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKA
LISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKR
SMSNWKLSKALSLEMIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELVKVKNENVAF
AMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELW
SILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAK
KIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGIDQMMTY
NLILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGL
KARSLPSPLQRELNGPIDHSYFDKYPPEKGMPPDELSGWDKDF
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggtggaatgcatgtatgggagaaactatcagcaagggagttacattattaagcaagga
gaaccaggaaaccatatctttgtgctggcagagggtcgactagaggtgtttcaaggggag
aaattgctgtcctccatccctatgtggaccacatttggggagcttgccattttatacaac
tgtacaaggactgcctctgtgaaagctattaccaatgttaaaacatgggcactagatcga
gaggtattccagaatataatgaggagaacagcccaagctagagatgaacaatacagaaac
ttcctcagaagtgtatccttgctgaagaatttacctgaagataaattaaccaagatcatt
gactgcttggaagtggaatactatgataaaggagattacatcattagagagggcgaggaa
ggaagtacctttttcattttggcaaaaggaaaggtaaaagtaacacagagtacagaaggc
catgatcaaccacagctgataaaaacactgcagaaaggagaatactttggagaaaaagct
cttatcagtgatgatgtcaggtcagctaacattattgctgaagaaaatgatgttgcatgc
ctggttatagatcgagaaacattcaaccaaactgttggtacatttgaagagctgcaaaaa
taccttgaaggatatgtggcaaacctgaaccgtgatgatgaaaaaagacatgcaaagcgg
tccatgtctaactggaagctgtccaaagcactctctctggaaatgattcagctgaaggag
aaggtggccagattttcctcatcatccccattccagaaccttgagattattgcaacactg
ggcgttggtgggttcggaagagttgagcttgttaaagtaaaaaatgagaatgtcgctttt
gctatgaagtgtataaggaagaagcacatagttgacaccaagcagcaggagcatgtctac
tcagagaagaggatcttagaggagctgtgctctccattcattgtgaaattatatcgtact
ttcaaggacaataagtatgtatacatgcttctggaggcctgcttaggtggggagctatgg
agtatattaagggacagaggcagctttgatgaacccacctccaaattctgcgttgcttgt
gtgacagaagcatttgattacctgcatcgactaggtattatctacagagacttaaaacca
gaaaacttaattctagatgctgagggttaccttaaattggttgactttggatttgcgaag
aaaatagggtctggacagaaaacatggacattctgtgggactccagaatatgtagctcct
gaagtcattctcaacaaaggacatgacttcagtgtggatttctggtcactgggaattcta
gtgtatgagcttctaacgggcaacccacccttttctgggattgaccaaatgatgacctac
aatttgattctcaaaggaattgaaaaaatggattttcccaggaagataacacgacgacct
gaggatttgattcgaaggctttgcaggcaaaatccaacagaaaggctgggaaatctgaag
aatggaataaatgacattaagaaacacaggtggttaaatggttttaattgggagggactg
aaagcacggagccttccatcgcctttacaaagagagctcaatggacccatagatcacagc
tactttgacaaataccctcctgaaaagggaatgcctccagatgagctatcaggctgggat
aaagacttctga

DBGET integrated database retrieval system