KEGG   Macaca mulatta (rhesus monkey): 696506Help
Entry
696506            CDS       T01028                                 

Definition
histone H2B type 1-H-like
Orthology
K11252  
histone H2B
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    696506
  Immune diseases
   05322 Systemic lupus erythematosus
    696506
  Substance dependence
   05034 Alcoholism
    696506
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   696506
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagccagccaagtctgctcccgccccgaagaagggctccaagaaggcggtgacc
aaggcgcagaaaaaagatgggaaaaagcgcaagcgcagccgcaaggagagctactctgtt
tatgtgtacaaggtgctgaagcaggtccaccccgacaccggcatctcttccaaggcgatg
gggatcatgaattctttcgttaacgacatatttgagcgtatcgcgggggaggcttcccgc
ctggcgcattacaacaagcgctcgaccatcacctccagggagatacagactgccgtgcgc
ctgctccttcccggagagctggcgaagcacgccgtgtcggagggcaccaaggccgtcacc
aagtacaccagctccaagtaa

DBGET integrated database retrieval system