KEGG   Macaca mulatta (rhesus monkey): 696628Help
Entry
696628            CDS       T01028                                 

Gene name
GPR37
Definition
G protein-coupled receptor 37 (endothelin receptor type B-like)
Orthology
K04243  
G protein-coupled receptor 37 (endothelin receptor type B-like)
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Parkinson's disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    696628 (GPR37)
G protein-coupled receptors [BR:mcc04030]
 Class A. Rhodopsin family
  Cardiovascular peptide
   Endothelin B like
    696628 (GPR37)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 613 aa AA seqDB search
MRAPGALLARMSRLLLLLLLKVSASSALGFAPASRNETCLGENCSPTVIQRRVRDVWGPG
NSARDVLRARAPREEQGAAVLAAPSWDLPAAPGREPAAGRRAEASAAGTPGPPTRPPGPW
RWKGARGQEPPESLGRGSPTALQLFLQISEEEEKGPRGAGISGRSQEQSVKTVPGANDLF
YWPRRAGKLQGSHHKPPPKTANGPAGHEGRTIALPGRALAQNGSLGEGIHEPGGPRRGNS
TNRRVRLKNPFYPLTQESYGAYAVMCLSVVIFGTGIIGNLAVMCIVCHNYYMRSISNSLL
ANLAFWDFLIIFFCLPLVIFHELTKKWLLEDFSCKIVPYIEVASLGVTTFTLCALCIDRF
RAATNVQMYYEMIENCSSTTAKLAVIWVGALLLALPEVVLRQLSKEDLGFSGRAPAERCI
IKISPDLPDTIYVLALTYDSARLWWYFGCYFCLPTLFTITCSLVTARKIRKAEKACTRGN
KRQIQLESQMNCTVVALTILYGFCIIPENICNIVTAYMATGVSQQTMDLLNIISQFLLFF
KSCVTPVLLFCLCKPFSRAFMECCCCCCEECIQKSSTVTSDDNDNEYTTELELSPFSTIR
REMSTFASVGTHC
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgcgagccccgggcgcgcttctcgcccgcatgtcgcggctactgcttctgttactgctc
aaggtgtctgcttcttctgccctcgggttcgcccctgcgtccaggaacgaaacttgtctg
ggggagaactgttcacctacagtgatccagcgccgcgtcagggacgtctggggaccagga
aattctgcaagagacgttctgcgagcccgagcacccagggaggagcagggggcagcggtg
cttgcggcgccctcctgggacctgccagctgccccgggccgtgaaccggctgcaggcaga
agggcggaggcgtcggcagctggaaccccgggacctccaaccaggccacctggcccctgg
aggtggaaaggtgctcggggtcaggagcctcctgaaagtttggggagagggagccccacg
gccctccagctcttccttcagatctcagaggaggaagagaagggtcccagaggcgctggc
atttccgggcgcagccaggagcagagtgtgaagacagtgcccggagctaacgatcttttt
tactggccaaggagagccgggaaactccaaggttcccaccacaagcccccacccaagacg
gccaatggaccggcggggcacgaagggcggacaattgcactcccgggccgggcgctggcc
cagaatgggtctttgggtgaaggaatccatgagcctgggggtccccgccggggaaacagc
acaaaccggcgcgtgagactgaagaaccccttctacccgctgacccaggagtcctatgga
gcctacgcggtcatgtgtctgtccgtggtgatcttcgggaccggcatcattggcaacctg
gcggtgatgtgcatcgtctgtcacaactactacatgcggagcatctccaactccctcttg
gccaacctggccttctgggactttctcattatcttcttctgccttccactggtcatcttc
cacgagctgaccaagaagtggctgctggaggacttctcctgcaagatcgtgccctatata
gaggtcgcttctctgggagtcaccactttcaccttatgtgctctgtgcatagaccgtttc
cgtgctgccaccaacgtacagatgtactatgaaatgatcgaaaactgttcctcaacaact
gccaaactggctgtcatatgggtgggagctctactgttagcacttccagaagttgttctc
cgccagctgagcaaggaggatttggggtttagtggccgagctccagcagaaaggtgcata
attaagatctctcctgatttaccggacaccatctatgttctagccctcacctacgacagt
gcgagactctggtggtattttggctgttacttttgtttgcccacacttttcaccatcacc
tgctctctagtgactgcgaggaaaatccgcaaagcagagaaagcctgtacccgagggaat
aagcggcagattcaactagagagccagatgaactgtacggtagtggcactgaccatttta
tatggattttgcattattcctgagaatatctgcaacattgttactgcctacatggctaca
ggggtttcgcagcagacaatggacctcctaaatatcatcagccagttccttttgttcttt
aagtcctgtgtcaccccagtcctccttttctgtctctgcaaacccttcagtcgggccttc
atggagtgctgctgctgttgctgtgaggaatgcattcagaagtcttcaacggtgaccagt
gatgacaatgacaacgagtacaccacagaactcgaactctcgcctttcagtaccatacgc
cgtgaaatgtccacttttgcttctgtcggaactcattgctga

DBGET integrated database retrieval system