KEGG   Macaca mulatta (rhesus monkey): 696635Help
Entry
696635            CDS       T01028                                 

Gene name
GK2
Definition
glycerol kinase 2 (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mcc00561]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:mcc03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 553 aa AA seqDB search
MADPKTAAVGPLVGAVVQGTNSTRFLVFSSKTAELLSHHKVELTQEFPKEGWVEQDPKEI
LQSVYECIARTCEKLDEMNIDISNIKAVGISNQRETTVIWDKLTGEPLYNAVVWLDLRTQ
TTVEDLSKKIPGNSNFVKSKTGLPLSTYFSAVKLRWMLDNVRHVQKAVEEGRALFGTIDS
WLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKELCDFFEIPMDLLPNVFSSSEIY
GLIKTGALEGVPISGCLGDQCAALVGQMCFQEGQAKNTYGTGCFLLCNTGRKCVFSEHGL
LTTIAYKLGKEKPAYYALEGSVAIAGAVIRWLRDNLGIIETSGDIEKLAKEVGTSYGCYF
VPAFSGLYAPYWEPSARGILCGLTQFTNKCHIAFAALEAVCFQTREILEAMNRDCGIPLR
HLQVDGGMTNNKVLMQLQADILHIPVIKPFMPETTALGAAMAAGAAEGVSVWSLEPQALS
VLRMERFEPQIQATESEIRYATWKKAVMKSMGWVTSQSPESGDPSIFSSMPLGFFIVSSM
VMLIGARYISGMP
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggcagacccgaagacagcagctgtggggccgttggtgggagcggtggtccagggcacc
aactccactcgctttctggttttcagttcaaaaacagcggaactacttagtcatcataaa
gtggaattaacacaagagttcccaaaagaaggatgggtggaacaagaccctaaggaaatt
cttcagtctgtctatgagtgtatagcgagaacgtgtgagaaacttgacgaaatgaatatt
gatatatccaacataaaagctgttggtatcagcaatcagagggaaaccactgtaatctgg
gacaagttaactggagagcctctctacaacgctgtggtgtggcttgatctaagaacccag
actactgttgaggatcttagtaaaaaaattccaggaaatagtaacttcgtcaagtctaag
acaggccttccacttagcacttacttcagtgcagtaaaacttcgttggatgcttgacaat
gtgagacatgtccaaaaggctgttgaagaaggtagagctctttttggtaccattgattca
tggcttatctggagtttgacaggaggagttaatggaggtgtgcattgtacagatgtaaca
aatgcaagcaggacaatgctttttaatatccattctttggaatgggataaagagctctgt
gacttttttgaaattccaatggaccttcttccaaatgtcttcagttcttctgagatctat
ggcctaattaaaactggggccctggaaggtgtgccaatatctgggtgtttgggggaccag
tgtgctgcattagtaggacaaatgtgcttccaggaaggacaagccaaaaacacctatgga
acaggttgcttcttactatgtaatacaggtcgtaaatgtgtgttttctgaacatggcctt
ctgaccacaatagcttacaaattaggcaaagagaagccagcatattatgcactggaaggt
tctgttgctatagcgggtgctgttattcgttggctaagagacaatcttggaattatagag
acctcaggagacattgaaaaacttgctaaagaagtaggaacttcttatggctgttacttt
gtcccagccttttcagggttatatgcaccttattgggaacccagtgcaagaggaatactc
tgtggtcttactcagtttaccaataaatgtcatattgcttttgctgcattagaagctgtt
tgtttccaaacccgagagattttggaagccatgaaccgtgactgtggaattccacttcgt
catttgcaggtagatggaggaatgaccaacaacaaagttcttatgcaactacaagcagat
attctgcatattccagtaataaaaccctttatgcctgaaacaactgcactaggagctgcc
atggcagcaggagctgcagagggagtaagcgtttggagccttgaaccccaggctttgtcg
gttctcaggatggaacgatttgaaccacagatccaggccacagaaagtgaaattcgttat
gccacatggaagaaagctgtaatgaagtcaatgggttgggttaccagtcagtctcctgaa
agtggtgatccttctatcttctctagtatgcctttgggattttttatagtgagtagcatg
gtaatgctaattggagcaagatatatctcaggtatgccgtaa

DBGET integrated database retrieval system