KEGG   Macaca mulatta (rhesus monkey): 696672Help
Entry
696672            CDS       T01028                                 

Gene name
USP28
Definition
ubiquitin specific peptidase 28
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.4.19.12]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     696672 (USP28)
Peptidases [BR:mcc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   696672 (USP28)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
14
AA seq 1077 aa AA seqDB search
MTAELQQDDAAGAADGHSSSCQMLLNQLREITGIQDPSFLHEALKASNGDITQAVSLLTD
ERVKEPSQDTVATEPSEVEGSAANKEVLAKVIDLTHDNKDDLQAAIALSLLESPKIQADG
RDLNRMHEATSAETKRSKRKRCEVWGENPNPNDWRRVDGWPVGLKNVGNTCWFSAVIQSL
FQLPEFRRLVLSYNLPQNVLENCRSHTEKRNIMFMQELQYLFALMMGSNRKFVDPSAALD
LLKGAFRSSEEQQQDVSEFTHKLLDWLEDAFQLAVNVNSPRNKSENPMVQLFYGTFLTEG
VREGKPFCNNETFGQYPLQVNGYRNLDECLEGAMVEGDVELLPSDHSVKYGQERWFTKLP
PVLTFELSRFEFNQSLGQPEKIHNKLEFPQIIYMDRYMYRSKELIRNKRECIRKLKEEIK
ILQQKLERYVKYGSGPARFPLPDMLKYVIEFASTKPASESCPPESDTHMTLPLSSVHCPV
SDQTSKESTSTESSSLDVESTFSSPEDSLHKSKPLTSSRSSMEMPAQPAPRTVTDEEINF
VKTCLQRWRSEIEQDIQDLKNCIASTTQTIEQMYCDPLLRQVPYRLHAVLVHEGQANAGH
YWAYIYNQPRQSWLKYNDISVTESSWEEVERDSYGGLRNVSAYCLMYINDKLPYFNAEAA
PNESDQMSEVEALSVELKHYIQEDNWRFEQEVEEWEEEQSCKIPQMESSTNSSSQDFSTS
QEPSVASSHGVRCLSSEHAVIVKEQTAQAIANTARAYEKSGVEAALSEVMLSPAMQGVIL
AIAKARQTFDRDGSEAGLIKAFHEEYSRLYQLAKETPTSHSDPRLQHVLVYFFQNEAPKR
VVERTLLEQFADKNLSYDERSISIMKVAQAKLKEIGPDDMNMEEYKKWHEDYSLFRKVSV
YLLTGLELYQKGKYQEALSYLVYAYQSNAALLMKGPRRGVKESVIALYRRKCLLELNAKA
ASLFETNDDHSVTEGINVMNELIIPCIHLIINNDISKDDLDAIEVMRNHWCSYLGQDIAE
NLQLCLGEFLPRLLDPSAEIIVLKEPPTIRPNSPYDLCSRFAAVMESIQGVSTVTVK
NT seq 3234 nt NT seq  +upstreamnt  +downstreamnt
atgactgcggagctgcagcaggacgacgcggccggcgcggccgacggccacagctcgagc
tgccaaatgctgttaaatcaactgagagaaatcacaggcattcaggacccttcctttctc
catgaagctctgaaggccagtaatggtgacattactcaggcagtcagccttctcactgat
gagagagttaaggagcctagtcaagacactgttgctacagaaccatctgaagtagaaggg
agtgctgccaacaaggaagtattagcaaaagtgatagaccttactcatgataacaaagat
gatcttcaggctgccattgctttgagtctgttggagtctcccaaaattcaagctgatgga
agagatcttaacaggatgcatgaagcaacctctgcagaaactaaacgctcaaagagaaaa
cgctgtgaagtctggggagaaaaccccaatcccaatgactggaggagagttgatggttgg
ccagttgggctgaaaaatgttggcaatacgtgttggtttagtgctgttattcagtctctc
tttcaattgcctgaatttcgaagactcgttctcagttataatctgccacaaaatgtactt
gaaaattgtcgaagtcacacagaaaagagaaatatcatgtttatgcaagagcttcagtat
ttgtttgctctaatgatgggatcaaatagaaaatttgtagacccgtctgcagccctggat
ctattaaagggagcattccggtcatctgaggaacagcagcaagatgtgagtgaattcaca
cacaagctcctggattggctagaggacgcattccagctagctgttaatgttaacagtccc
aggaacaaatctgaaaatccaatggtgcagctgttctatggtactttcctgactgaaggg
gttcgtgaaggaaaacccttttgtaacaatgagacctttggccagtatcctcttcaggta
aacggttatcgcaacttagacgagtgtttggaaggggccatggtggagggtgatgttgag
cttcttccctctgatcactcagtgaagtatggacaagagcgttggtttacaaagctacct
ccagtgttgacctttgaactctcaagatttgagtttaatcagtcccttgggcagccagag
aaaattcacaataagctggaatttcctcagattatttatatggacaggtacatgtacagg
agcaaggagcttattcgaaataagagagagtgtattcgaaagttgaaggaggaaataaaa
attctgcagcaaaaattggaaaggtatgtgaaatatggctcaggcccagctcggttcccg
ctcccggacatgctgaaatatgttattgaatttgctagtacaaaacctgcctcagaaagc
tgtccacctgaaagtgacacacacatgacattaccactttcttcagtgcactgcccagtt
tctgaccagacatccaaggaaagtacaagtacagaaagctcttctctggatgttgaaagt
accttttcttctcctgaagattctctacacaagtctaaaccactgacatcttctcggtct
tccatggaaatgcctgcacagccagctccacgaacagtcacagatgaggagataaacttt
gttaagacctgtcttcagaggtggaggagtgagattgaacaagatatacaagatttaaag
aattgtattgcaagtactactcagactattgaacagatgtactgcgatcctctccttcgt
caggtgccttatcgcttgcatgcagttcttgttcatgaaggacaagcaaatgctggacac
tattgggcctatatctataatcagccccgacagagctggctcaagtacaatgacatctct
gttactgaatcttcctgggaagaagttgaaagagattcctatgggggcctgagaaatgtt
agtgcttactgtctgatgtacattaatgacaaactaccctacttcaatgcagaggcagcc
cctaatgaatcagatcaaatgtcagaagtggaagccctatctgtggaactcaagcattac
attcaggaggataactggcggtttgagcaggaagtagaggagtgggaagaagagcagtct
tgcaaaatccctcaaatggagtcctccaccaactcctcatcacaggacttctctacatcg
caagagccttcagtagcctcttctcatggggttcgctgcttgtcatctgagcatgctgtg
attgtaaaggagcaaactgcccaggctattgcaaacacagcccgtgcctatgagaagagc
ggtgtagaagcggcactgagtgaggtgatgctgagccctgccatgcaaggggtcatcctg
gccatagctaaagcccgtcagacctttgaccgagatgggtctgaagcagggctgattaag
gcattccatgaagaatactccaggctttatcagcttgccaaagagacccccacctctcac
agtgatcctcgacttcaacatgtccttgtctactttttccaaaatgaagcacctaaaagg
gtagtagaacgaaccctactggaacagtttgcagataaaaatcttagctatgatgaaaga
tcaatcagcattatgaaggtggctcaagcgaaactgaaggaaattggtccagatgacatg
aatatggaagagtacaagaagtggcatgaagattatagtttgttccgaaaagtgtctgtg
tatctactaacaggcctagaactctatcaaaaaggaaagtaccaagaggcactttcctac
ctggtgtatgcctaccagagcaatgccgccctgctgatgaaggggccccgccggggggtc
aaggaatccgtgattgctctgtaccgaagaaaatgccttctggagctgaatgccaaagca
gcttctctctttgaaacaaatgatgatcactctgtaactgagggcattaatgtgatgaat
gaactgatcatcccctgcattcaccttatcattaataatgacatttccaaggatgacctg
gatgccattgaggtcatgagaaaccattggtgctcttaccttgggcaagatattgcagaa
aatctgcagctgtgcctaggggagtttctacccagacttttagatccttctgcagaaatc
atcgtcttgaaggagcctccaactattcgacccaattctccttatgacctatgtagccga
tttgcagctgtcatggagtcaattcaaggagtttcaactgtgacagtgaaataa

DBGET integrated database retrieval system