KEGG   Macaca mulatta (rhesus monkey): 696709Help
Entry
696709            CDS       T01028                                 

Gene name
RAC2
Definition
ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
Orthology
K07860  
Ras-related C3 botulinum toxin substrate 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Wnt signaling pathway
Axon guidance
VEGF signaling pathway
Focal adhesion
Adherens junction
Natural killer cell mediated cytotoxicity
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Pathways in cancer
Colorectal cancer
Pancreatic cancer
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    696709 (RAC2)
   04015 Rap1 signaling pathway
    696709 (RAC2)
   04010 MAPK signaling pathway
    696709 (RAC2)
   04310 Wnt signaling pathway
    696709 (RAC2)
   04370 VEGF signaling pathway
    696709 (RAC2)
   04024 cAMP signaling pathway
    696709 (RAC2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    696709 (RAC2)
  Cell communication
   04510 Focal adhesion
    696709 (RAC2)
   04520 Adherens junction
    696709 (RAC2)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    696709 (RAC2)
   04662 B cell receptor signaling pathway
    696709 (RAC2)
   04664 Fc epsilon RI signaling pathway
    696709 (RAC2)
   04666 Fc gamma R-mediated phagocytosis
    696709 (RAC2)
   04670 Leukocyte transendothelial migration
    696709 (RAC2)
   04062 Chemokine signaling pathway
    696709 (RAC2)
  Development
   04360 Axon guidance
    696709 (RAC2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    696709 (RAC2)
   05210 Colorectal cancer
    696709 (RAC2)
   05212 Pancreatic cancer
    696709 (RAC2)
  Cardiovascular diseases
   05416 Viral myocarditis
    696709 (RAC2)
GTP-binding proteins [BR:mcc04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    696709 (RAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR
DDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRQQKRACSLL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagatggggccgtgggcaagacctgccttctc
atcagctacaccaccaacgccttccccggagagtacatccccaccgtgtttgacaactat
tcagccaatgtgatggtggacagcaagccggtgaacctggggctgtgggacactgctggg
caggaggactacgaccgtctccggccactctcctacccacagacggacgtcttcctcatc
tgcttctccctcgtcagcccagcctcctatgagaacgtccgtgccaagtggttcccggaa
gtgcggcaccactgccccagcacacccatcatcctggtgggcaccaagctggacctgcgg
gacgacaaggacaccatcgagaaactgaaggagaagaagctggctcccatcacctaccct
cagggcctggcactggccaaggagattgactcggtgaaatatctggagtgctcagccctc
acccagagaggcctgaaaaccgtgttcgacgaagccatccgggccgtgctgtgccctcag
cccacgcggcagcagaagcgcgcctgcagcctcctctag

DBGET integrated database retrieval system