KEGG   Macaca mulatta (rhesus monkey): 696872Help
Entry
696872            CDS       T01028                                 

Definition
uncharacterized LOC696872
Orthology
K11275  
histone H1/5
Organism
mcc  Macaca mulatta (rhesus monkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 440 aa AA seqDB search
MSETAPAAPAAPAPAEKTPVKKKARKSAGAAKRKASGPPVSELITKAVAASKERSGVSLA
ALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKA
KKAGAAKAKKPTGAAKKPKKATGAATPKKSAKKTPKKAKKPAAAAGAKKAKSPKKAKAAK
PKKAPKSPAKAKAVKPKAAKPKTAKPKAAKPKKAAAKKNKRAVTLSGGVAGKTPLLRGGS
PGNKVGREEPFLARGSFRVPSAKQECSRVIELLLRFRILELKPISTSVTMASNGVQRMII
FSGVCDSVVIINVAMPEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVL
KQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGE
LAKHAVSEGTKAVTKYTSSK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagactgcgcccgccgcgcccgctgctccggcccctgccgagaaaacacccgtg
aagaagaaggctcgcaagtccgcaggtgcggctaagcgcaaagcgtctgggccccccgtg
tccgagctcattactaaggctgttgccgcctccaaggagcgcagcggtgtatctttggcc
gctctcaagaaagcgctggcagccgctggctatgacgtggagaagaacaacagccgcatc
aagctgggtctcaagagcctggtgagcaagggcactctggtgcagaccaagggcaccggc
gcatcgggttctttcaaactcaacaagaaggcggcctccggggaagccaagcctaaagct
aaaaaggcaggcgcggccaaagccaagaagcctacaggagcggcgaagaagcccaagaag
gcgacgggggcagccacccctaagaagagcgccaagaagaccccaaagaaggcgaagaag
ccggctgcggctgctggagccaaaaaagcgaaaagcccgaaaaaggctaaagcagccaag
ccaaaaaaagcgcccaagagcccagcgaaggccaaagcagtgaaacccaaggcggctaaa
ccaaagaccgccaagcccaaggcagccaagccaaagaaggcggcagccaagaaaaataaa
agagctgttacactatcagggggtgtggccgggaaaacgccgctattgaggggcgggtct
cccgggaacaaagtcgggagagaggagccgtttttggccagggggtcatttcgcgttccg
tcggccaagcaggagtgcagccgcgtcattgagcttttattgcgttttcgaatactggag
ttaaaacccatttcgacctccgtaactatggcaagcaatggagtgcagaggatgattatt
ttctcaggtgtttgcgacagtgttgtaattattaacgttgctatgcctgagcctaccaag
tctgctcctgccccaaagaagggctccaagaaggcggtgactaaggcgcagaagaaggac
gggaagaagcgcaagcgcagccgcaaagagagctattccgtgtatgtgtacaaggtgctg
aagcaggtccaccccgacaccggcatctcttccaaggctatggggatcatgaattccttc
gtcaacgacatcttcgagcgcatcgccggcgaggcttcccgcctggcgcactacaacaag
cgctcgaccatcacttccagggagatccagacggccgtgcgcctgctgcttccgggggag
ctggccaagcacgccgtgtcggagggcaccaaggccgtcaccaagtacaccagttccaag
taa

DBGET integrated database retrieval system