KEGG   Macaca mulatta (rhesus monkey): 696872Help
Entry
696872            CDS       T01028                                 

Definition
(RefSeq) histone H1.4
  KO
K11275  
histone H1/5
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Chromosome [BR:mcc03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    696872
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 219 aa AA seqDB search
MSETAPAAPAAPAPAEKTPVKKKARKSAGAAKRKASGPPVSELITKAVAASKERSGVSLA
ALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKA
KKAGAAKAKKPTGAAKKPKKATGAATPKKSAKKTPKKAKKPAAAAGAKKAKSPKKAKAAK
PKKAPKSPAKAKAVKPKAAKPKTAKPKAAKPKKAAAKKK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagactgcgcccgccgcgcccgctgctccggcccctgccgagaaaacacccgtg
aagaagaaggctcgcaagtccgcaggtgcggctaagcgcaaagcgtctgggccccccgtg
tccgagctcattactaaggctgttgccgcctccaaggagcgcagcggtgtatctttggcc
gctctcaagaaagcgctggcagccgctggctatgacgtggagaagaacaacagccgcatc
aagctgggtctcaagagcctggtgagcaagggcactctggtgcagaccaagggcaccggc
gcatcgggttctttcaaactcaacaagaaggcggcctccggggaagccaagcctaaagct
aaaaaggcaggcgcggccaaagccaagaagcctacaggagcggcgaagaagcccaagaag
gcgacgggggcagccacccctaagaagagcgccaagaagaccccaaagaaggcgaagaag
ccggctgcggctgctggagccaaaaaagcgaaaagcccgaaaaaggctaaagcagccaag
ccaaaaaaagcgcccaagagcccagcgaaggccaaagcagtgaaacccaaggcggctaaa
ccaaagaccgccaagcccaaggcagccaagccaaagaaggcggcagccaagaaaaagtag

DBGET integrated database retrieval system