KEGG   Macaca mulatta (rhesus monkey): 696996Help
Entry
696996            CDS       T01028                                 

Definition
histone H2B type 1-C/E/F/G/I-like
Orthology
K11252  
histone H2B
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    696996
  Immune diseases
   05322 Systemic lupus erythematosus
    696996
  Substance dependence
   05034 Alcoholism
    696996
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   696996
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 143 aa AA seqDB search
MRCRFHFDSYLQNSEGSMPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVY
KVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLL
PGELAKHAVSEGTKAVTKYTSSK
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgagatgtagatttcattttgattcctacttgcagaacagcgaaggtagcatgcctgag
ccagcgaaatccgctccggccccaaagaagggctccaaaaaggccgtgaccaaggcgcag
aagaaggacggcaagaagcgcaagcgcagccgaaaagagagctactccgtatacgtgtac
aaggtgctgaaacaggtccatcccgacaccggcatctcctccaaagccatggggatcatg
aattcctttgtcaacgacatcttcgagcgcatcgccggcgaggcttcccgcctggcgcat
tacaacaagcgttcgaccatcacctccagggagatccagacggcagtgcgcctgctgctg
cccggggagctggccaagcacgccgtgtcggagggcaccaaggccgtcaccaagtacacg
agctccaagtaa

DBGET integrated database retrieval system