KEGG   Macaca mulatta (rhesus monkey): 697002Help
Entry
697002            CDS       T01028                                 

Gene name
PDGFRA
Definition
alpha-type platelet-derived growth factor receptor-like
Orthology
K04363  
platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
Cytokine-cytokine receptor interaction
Endocytosis
PI3K-Akt signaling pathway
Focal adhesion
Gap junction
Regulation of actin cytoskeleton
HTLV-I infection
Pathways in cancer
MicroRNAs in cancer
Glioma
Prostate cancer
Melanoma
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    697002 (PDGFRA)
   04015 Rap1 signaling pathway
    697002 (PDGFRA)
   04010 MAPK signaling pathway
    697002 (PDGFRA)
   04020 Calcium signaling pathway
    697002 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    697002 (PDGFRA)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    697002 (PDGFRA)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    697002 (PDGFRA)
  Cell motility
   04810 Regulation of actin cytoskeleton
    697002 (PDGFRA)
  Cell communication
   04510 Focal adhesion
    697002 (PDGFRA)
   04540 Gap junction
    697002 (PDGFRA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    697002 (PDGFRA)
   05206 MicroRNAs in cancer
    697002 (PDGFRA)
   05214 Glioma
    697002 (PDGFRA)
   05218 Melanoma
    697002 (PDGFRA)
   05215 Prostate cancer
    697002 (PDGFRA)
  Infectious diseases
   05166 HTLV-I infection
    697002 (PDGFRA)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     697002 (PDGFRA)
Protein kinases [BR:mcc01001]
 Tyrosine protein kinases
  PDGFR family [OT]
   697002 (PDGFRA)
Enzyme-linked receptors [BR:mcc01020]
 Receptor tyrosine kinases
  RTK class III (PDGF receptor family)
   697002 (PDGFRA)
Cytokine receptors [BR:mcc04050]
 Receptor tyrosine kinase
  RTK class III (PDGF receptor family)
   697002 (PDGFRA)
Cellular antigens [BR:mcc04090]
 Proteins
  697002 (PDGFRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 1121 aa AA seqDB search
MSVFIPRLRFGGTTLQPVVWSAAGGPGEFPRAMGTSHPAFLVLGCLLTGLSLILCQLSLP
SILPNENEKVVQLNSSFSLRCFGESEVSWQYPMSEEENSDVEIRNEENNSGLFVTVLEVS
SASAAHTGLYTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAII
PCRTTDPETPVTLHNSEGVVPASYNSRQGFNGTFTVGPYICEATVKGKKFQTIPFNVYAL
KATSELDLEMEALKTVYKSGETIVVTCAVFNNEVVDLQWTYPGEVKGKGITMLEEIKVPS
IKLVYTLTVPEATVKDSGDYECAARQATREVKEMKRVTISVHEKGFIEIKPTFSQLEAVN
LHEVKHFVVEVQAYPPPRISWLKNNLTLIENLTEITTDVEKIQEIRYRSKLKLIRAKEED
SGHYTIVAQNEDDVKSYTFELLTQVPSSILDLVDDHHGSTGGQTVRCTAEGMPLPDIEWM
ICKDIKKCNNETSWTILANNVSNIITEIHPRDRSTVEGLVTFAKVEETIAVRCLAKNLLG
AENRELKLVAPTLRSELTVAAAVLVLLVIVIISLIVLVVIWKQKPRYEIRWRVIESISPD
GHEYIYVDPMQLPYDSRWEFPRDGLVLGRVLGSGAFGKVVEGTAYGLSRSQPVMKVAVKM
LKPTARSSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHK
NRDSFLSRHPEKPKKELDIFGLNPADDSTRSYVILSFENNGDYMDMKQADTTQYVPMLER
KEVSKYSDIQRSLYDRPASYKKKSMLDSEVKNLLSDDNSEGLTLLDLLSFTYQVARGMEF
LASKNCVHRDLAARNVLLAQGKIVKICDFGLARDIMHDSNYVSKGSTFLPVKWMAPESIF
DNLYTTLSDVWSYGILLWEIFSLGGTPYPGMMVDSTFYNKIKSGYRMAKPDHATSEVYEI
MVKCWNSESEKRPSFYHLSEIVENLLPGQYKKSYEKIHLDFLKSDHPAVARMRVDSDNAY
IGVTYKNEEDKLKDWEGGLDEQRLSADSGYIIPLPDIDPVPEEEDLGKRNRHSSQTSEES
AIETGSSSSTFIKREDETIEDIDMMDDIGIDSSDLVEDSFL
NT seq 3366 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttttcattcctcgcctgcggtttggcgggacaacgctgcagcccgtggtgtgg
agcgcggctgggggaccaggggagtttcccagagctatggggacttcccatccggcgttc
ctggtcttaggctgtcttctcacagggctgagcctaatcctctgccagctttcgttaccc
tctatccttccaaatgaaaatgaaaaggttgtgcagctgaattcatccttttctctgaga
tgctttggggagagtgaagtgagctggcagtaccccatgtctgaagaagagaactctgat
gtggaaatcagaaatgaagaaaacaacagtggcctttttgtgacagtcttggaagtgagc
agtgcctcggcggcccacacagggctgtacacttgctattacaaccacactcagacagaa
gagaatgagcttgaaggcaggcacatttacatctatgtgccagacccagatgtagccttt
gtacctctaggaatgacggattatttagtcatcgtggaggacgatgattctgccatcata
ccttgtcgcacaactgatcctgagactcctgtaactttacacaacagtgagggggtggta
cctgcctcctacaacagcagacagggctttaatgggaccttcactgtagggccctatatc
tgtgaggccaccgtcaaaggaaagaagttccagaccatcccatttaacgtttatgcttta
aaagcaacatcagagctggatctagaaatggaagctcttaaaaccgtgtataagtcaggg
gaaacgattgtggtcacctgtgctgtttttaacaatgaggtggttgaccttcagtggact
taccctggagaagtgaaaggcaaaggcatcacaatgctggaagaaatcaaagtcccatcc
atcaaattggtgtacactttgacggtccccgaggccacggtgaaagacagtggagattac
gaatgtgctgcccgccaggctaccagggaggtcaaagaaatgaagagagtcactatttct
gtccatgagaaagggttcattgaaatcaaacccacctttagccagttggaagctgtcaac
ctgcatgaagtcaaacattttgtcgtagaggtgcaggcctacccacctcccaggatatcc
tggctgaaaaacaatctgactctgattgaaaacctcacggagatcaccactgatgtggaa
aagattcaggaaataaggtatcgaagcaaattaaagcttatccgtgctaaggaagaagac
agtggccattatactattgtagctcaaaatgaagatgatgtgaagagctatacttttgaa
ctgttaactcaagttccttcatccattctggacttggtcgatgatcaccatggctcaact
gggggacagacggtgaggtgcacagctgaaggcatgccacttcctgatattgagtggatg
atatgcaaggatattaagaaatgtaataatgaaacttcctggacgattttggccaacaat
gtctcaaacatcatcacggagatccacccccgagacaggagtactgtggagggccttgtg
acttttgccaaagtggaagagaccattgcggtgagatgcctggctaagaatctccttgga
gctgagaaccgagagctgaagctggtggctcccaccctgcgttctgaactcacggtggct
gccgcagtcctggtgctgctggtgattgtgatcatctcactcattgtcctggttgtcatt
tggaaacagaaaccgaggtatgaaattcgctggagggtcattgaatcaatcagcccagat
ggacatgaatatatttatgtggacccaatgcagctgccttatgactcgagatgggagttt
ccaagagatggactagtgcttggtcgggtcttggggtctggagcgtttgggaaggtggtt
gaaggaacagcctatggattaagccggtcccaacctgtcatgaaagttgcagtgaagatg
ctaaaacccacggccagatccagtgaaaaacaagctctcatgtctgaactgaagataatg
actcacctggggccacatttgaacattgtaaacttgctgggagcctgcaccaagtcaggc
cccatttacatcatcacagagtactgcttctacggagatttggtcaactatttgcataag
aatagggatagcttcctgagccgccacccagagaagccaaagaaagagctggatatcttt
gggttgaaccctgctgatgacagcacacggagctatgttattttatcttttgaaaacaat
ggtgactacatggacatgaagcaggctgatactacacagtatgtccctatgctagaaagg
aaagaggtttctaaatattccgacatccagagatcactgtatgatcgtccagcctcatat
aagaagaaatctatgttagactcagaagtcaaaaacctcctttcagatgataactcagaa
ggccttactttgttggatttgttgagcttcacctatcaagtcgcccgaggaatggagttt
ttggcttcaaaaaattgtgtccaccgggatctggctgctcgcaacgtcctcctggcacaa
ggaaaaattgtgaagatctgtgactttggcctggccagagacatcatgcatgattcgaac
tatgtgtcgaaaggcagtacctttctgcccgtgaagtggatggctcctgagagcatcttt
gacaacctctacaccacactgagtgatgtctggtcttacggcattctgctctgggagatc
ttttcccttggtggtactccttaccctggcatgatggtggattctactttctacaataag
atcaagagtgggtaccggatggccaagcctgaccatgctaccagtgaagtctacgagatc
atggtgaaatgctggaacagtgagtcagagaagagaccctccttttaccacctgagtgag
attgtggagaatctgctgcctggacaatataaaaagagttatgaaaaaattcacctggac
ttcctgaagagtgaccatcctgctgtggcacgcatgcgtgtggactcagacaatgcgtac
attggtgtcacctacaaaaatgaggaagacaagctgaaggactgggagggtggtctggat
gagcagagactgagcgctgacagcggctacatcattcctctgcctgacattgaccctgtc
cctgaggaggaggacctgggcaagaggaacagacacagctcgcagacctctgaagagagt
gccattgagacgggttccagcagttccaccttcatcaagagagaggacgagaccattgaa
gacatcgacatgatggacgacatcggcatagactcttcagacctggtggaagacagcttc
ctgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system