KEGG   Macaca mulatta (rhesus monkey): 697206Help
Entry
697206            CDS       T01028                                 

Gene name
TESK1
Definition
testis-specific kinase 1 (EC:2.7.12.1)
Orthology
K08841  
testis-specific kinase 1 [EC:2.7.12.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     697206 (TESK1)
Protein kinases [BR:mcc01001]
 Serine/threonine protein kinases: TKL group
  LISK family [Table]
   697206 (TESK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
15
AA seq 626 aa AA seqDB search
MAGERPPLRGPGPGPGEVPGEGPPGPGGAGGGPGRGRPSSYRALRSAVSSLARVDDFHCA
EKIGAGFFSEVYKVRHRQSGQVMVLKMNKLPSNRGNTLREVQLMNRLRHPNILRFMGVCV
HQGQLHALTEYMNGGTLEQLLSSPEPLSWPVRLRLALDIARGLRYLHSKGVFHRDLTSKN
CLVRREDRGFTAVVGDFGLAEKIPVYREGARKEPLAVVGSPYWMAPEVLRGELYDEKADV
FAFGIVLCELIARVPADPDYLPRTEDFGLDVPAFRTLVGDDCPLPFLLLAIHCCSLEPST
RAPFTEITQHLEWILEQLPEPAPLTRTPLTHNQGSVPRGGPSATLPRPDPRLSRSRSDLF
LPPSPESPPNWGDNLTRVNPFSLREDLRGGKIKLLDTPSKPVLPLVPPSPFPSTQLPLVT
TPETLVQPGTPARRCRSLPSSPELPRRMETALPGPGPPPVGPSAEEKMECEGSSPEPEPP
GPAPQLPLAVATDNFISTCSSATQPWSPRSGPVLNNNPPAVVVNSPQGWAGEPWNRAQHS
LPRAAALERTEPSPPPSAPREPDEGLPCPGCCLGPFSFGFLSMCPRPTPAVARYRNLNCE
AGSLLCHRGHHAKPPTPSLQLPGARS
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggccggggaacggcccccactgcggggccctgggcccgggcctggagaggtgccgggg
gaggggcccccggggccggggggcgcgggcggaggcccgggccgcggccgcccctcctcc
taccgggctctccgcagcgccgtgtctagcctggcccgtgtggacgattttcactgcgcg
gagaagatcggggccggcttcttctctgaggtctacaaggttcggcaccgacagtcaggg
caagtcatggtgctgaagatgaacaagctccccagtaaccggggcaacacactacgagaa
gtgcaactgatgaaccggctcaggcaccccaacatcctaaggttcatgggggtctgtgtg
caccagggacagctgcacgctcttacagagtatatgaatggggggaccttggaacagctg
ctcagctcccctgaacccctatcctggcctgtcaggctccgcctggccctggacattgcc
cgaggcctgcggtacctgcactccaaaggtgtatttcaccgggaccttacatccaagaac
tgtctagtccgacgggaagatcgaggcttcaccgctgtcgtgggtgacttcgggctggct
gaaaagattcctgtgtatagggagggggcaagaaaggagccattggctgtggtgggctcc
ccatactggatggctccagaggtgttacggggtgagctgtatgatgagaaggctgatgtc
tttgccttcggaattgtcctctgtgagctcatcgcccgagtacctgcagaccctgactac
ctaccacgcactgaggactttggcctggatgtgcctgccttccgaactctagtgggggat
gactgtccactgcctttcctgcttctggccatccattgctgcagcctggaacccagcacc
cgtgcccccttcaccgaaatcacccagcacctggaatggatcctggagcagctgcctgag
ccagccccactcaccaggactcccctgacacacaatcagggctctgttccaagagggggt
ccctctgccacgcttcctaggccagacccccggctttcccgaagccggtcagacctcttc
ctgcccccatcaccagaatcacccccaaactggggggacaatctgactcgagtcaacccc
ttctcactacgggaagacctcaggggtggcaagatcaagcttttggacacacccagcaag
ccagtcctgcctcttgtgccaccatcaccattcccctccactcagctgcccttggtgacc
accccggagacgctggtccagcctggaacacctgcccgccgctgccgctcactaccttca
tcccctgagctcccccgccgtatggagacagcacttccaggtcctggccctccccccgtg
ggcccctcggctgaagagaagatggagtgtgagggcagcagccctgagccggaacctcca
ggaccagcgccccagctgcctctggctgtggccacagacaacttcatcagcacctgttcc
tcggccacccaaccctggtcccctagatcaggacctgtcctcaataacaatcccccagct
gtggtggtgaactccccacaaggctgggctggggagccctggaaccgggcccagcatagc
ctgccccgggcggcagccctggagcggacagaaccctcgccacccccttcagctccccgg
gagcctgatgaggggctgccctgtcctggctgctgcctcggccccttcagctttggcttc
ctgtccatgtgcccccgccccacaccagctgttgcccgctaccgcaacctgaactgtgag
gcgggcagtctcctctgccaccgagggcaccatgccaagccacccacacccagcctgcag
ctgcctggggcacgctcttag

DBGET integrated database retrieval system