KEGG   Macaca mulatta (rhesus monkey): 697221Help
Entry
697221            CDS       T01028                                 

Gene name
BAP1
Definition
BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) (EC:3.4.19.12)
Orthology
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
mcc  Macaca mulatta (rhesus monkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 729 aa AA seqDB search
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLFKWIEERRSRR
KVSTLVDDTSVIDDDIVNNMFFAHQLIPNSCATHALLSVLLNCSNVDLGPTLSRMKDFTK
GFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSYVPITGRL
FELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIK
YEARLHVLKVNRQTVLEALQQLIRVTQPELIQTHKSQESQLPEESKSASNKSPLVLEANR
APAATEGTHTDGAEEAAGSCTQAPSHSPPSKPKLVVKPPGSSLNGVPPNPTPIVQRLPAF
LDNHNYAKSPMQEEEDLAAGVGRSRVPVRPPQQYSDDEDDYEDDEEDDVQNTNSAIRYKR
KGTGKPGALSGSADGQLSVLQPNTINVLAEKLKESQKDLSIPLSIKTSSGAGSPAVAVPT
HSQPSPTPSNESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGEDDSLLR
VDCIRYNRAVRDLGPVISTGLLHLAEDGVLSPLALTEGGKGSSPSIRPIQGSQGSSSPVE
KEVVEATDSREKTGLVRPGEPSSGEKYSPKELLALLKCVEAEIANYEACLKEEVEKRKKF
KIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKPDRRKR
SRPYKAKRQ
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgaataagggctggctggagctggagagcgacccgggcctcttcaccttgctggtggaa
gatttcggtgtcaaaggggtgcaagtggaggagatctacgaccttcagagcaaatgccag
ggccctgtatatggatttatcttcctgttcaaatggatcgaagagcgccggtcccggcga
aaggtctctaccttggtggatgatacgtccgtgattgatgatgatattgtgaataacatg
ttctttgcccaccagctgatacccaactcttgtgcgactcatgccttgctgagcgtgctc
ctgaactgcagcaacgtggacctgggacccaccctgagtcgcatgaaggacttcaccaag
ggcttcagccctgagagcaaaggatatgcgattggcaatgccccggagttggccaaggca
cataatagccatgccaggcccgagccacgccacctccctgagaagcagaatggccttagt
gcagtgcggaccatggaggcgttccactttgtcagctatgtgcctatcacaggccggctc
tttgagctggatgggctgaaggtctaccccattgaccatgggccctggggggaggatgag
gagtggacagacaaggcccggcgggtcatcatggagcgtattggcctcgccactgcaggg
gagccctaccacgacatccgcttcaacctgatggcagtggtgcccgatcgcaggatcaag
tatgaggccaggttgcatgtgctgaaggtgaaccgtcagacagtactagaggctttgcag
cagctgataagagtaacacagccggagctgattcagacccacaagtctcaagagtcacag
ctgcctgaggagtccaagtcagccagcaacaagtccccgctggtgctggaagcaaacagg
gcccctgcagccactgagggcacccacacagatggtgcagaggaggcggctggttcatgc
acacaagccccatcccatagccctcccagcaaacccaagctggtggtgaagcctccaggc
agtagcctcaacggtgttccccccaaccccactcccattgtccagcggctgccagccttt
ctagacaatcacaactatgccaagtcccccatgcaggaggaagaagacctggcagccggt
gtgggccgcagccgagttccagtccgcccaccccagcagtactcagatgatgaggatgac
tatgaggatgacgaggaggatgacgtgcagaataccaactctgccattaggtataagcgg
aagggaacagggaagccaggggcattgagcggttcagctgatgggcaactgtcagtgctg
cagcccaacaccatcaacgtcttggctgagaagctcaaagagtcccagaaggacctgtca
attcctctgtccatcaagactagcagcggggctgggagtccggctgtggcagtgcccaca
cactcgcagccctcgcccacccccagcaatgagagtacggacacggcctctgagatcggc
agtgctttcaactcgccactgcgctcgcccatccgctcggccaacccgacacggccctcc
agccctgtcacctcccacatctccaaggtgctttttggagaggatgacagcctgctgcgt
gttgactgcatacgctacaaccgtgctgtccgtgatctgggtcctgtcatcagcacaggc
ctgctgcacctggcggaggatggggtgctgagtcccctggcgctgacagagggtgggaag
ggttcctcgccctccatcagaccaatccaaggcagccaggggtccagcagcccagtggag
aaggaggtcgtggaagccacggacagcagagagaagacagggctggtgaggcctggcgag
ccctcgagtggggagaagtactcacccaaggagctgctggcactgctaaagtgtgtggag
gctgagattgcaaactatgaggcgtgcctcaaggaagaggtagagaagaggaagaagttc
aagattgatgaccagagaaggacccacaactacgatgagttcatctgcacctttatctcc
atgctggctcaggaaggcatgctggccaacctagtggagcagaacatctccgtgcggcgg
cgccaaggggtcagcatcggccggctccacaagcagcggaagcctgaccgacggaaacgc
tctcgcccctataaggccaagcgccagtga

DBGET integrated database retrieval system