KEGG   Macaca mulatta (rhesus monkey): 697232Help
Entry
697232            CDS       T01028                                 

Gene name
ASNS
Definition
asparagine synthetase (glutamine-hydrolyzing)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mcc00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 478 aa AA seqDB search
MQRHFEFEYQTNVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTYGVR
PLFKAITEDGFLAVCSEAKGLVTLKHSTTPFLKVEPFLPGHYEVLDLKPNGKVASVEMVK
YHHCRDEPLHALYDNVDKLFPGFEIETVKNNLRILFNNAVKKRLMTDRRIGCLLSGGLDS
SLVAATLLKQLKEAQVQYPLQTFAIGMEDSPDLLAARKVANHIGSEHYEVLFNSEEGIQA
LDEVIFSLETYDITTVRASVGMYLISKYIRKNTDNVVIFSGEGSDELTQGYIYFHKAPSP
EEAEEESERLLRELYLFDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPEMRTPKNGI
EKHLLRETFEESNLIPKEILWRPKEAFSDGITSVKNSWFKILQEYVEHQVDDAMMANAAQ
KFPFNTPKTKEGYYYRQIFERHYPGRADWLSHYWMPKWINATDPSARTLTHYKSAAKA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgccattttgaatttgaataccagaccaacgtggatggtgagataatccttcat
ctttatgacaaaggaggaattgagcaaacaatttgtatgttggatggtgtgtttgcattt
gttttactggatactgccaataagaaagtgttcctgggcagagatacatatggagtcaga
cctttgtttaaagcaataacagaagatggatttttggctgtatgttcagaagctaaaggt
cttgttacattgaaacactccacgactccctttttaaaagtggagccttttcttcctggg
cactatgaagttttggatttaaagccaaatggcaaagttgcatctgtggaaatggttaaa
tatcatcactgtcgggatgaacccctgcatgccctctatgacaatgtggacaaactcttt
ccaggttttgagatagaaactgtgaagaacaacctcaggatcctttttaataatgctgta
aagaaacgtttgatgacagacagaaggattggctgccttttatcagggggcttggactcc
agcttggttgctgccaccctgttgaagcagctgaaagaggcccaagtacagtatcctctc
cagacatttgcaattggcatggaagacagccccgatttactggctgctagaaaggtggca
aatcatatcggaagtgaacattatgaagtcctttttaactctgaggaaggcattcaggct
ctggatgaagtcatattttccttggaaacttacgacattacaacagttcgtgcttcagta
ggtatgtatttaatttccaagtatattcggaagaacacagataacgtggtgatcttctct
ggagaaggatcagatgaacttacgcagggttacatatattttcacaaggctccttctcct
gaagaagccgaggaggagagtgagaggcttctgagggaactctatttgtttgatgtcctc
cgcgcagatcgaactactgctgcccacggccttgaactgagagtcccatttctagatcat
cgattttcttcctattacttgtctctgccaccagaaatgagaactccaaagaatgggata
gaaaaacatctcctgagagagacgtttgaggagtccaatctgatacccaaagagattctc
tggcgaccaaaagaagccttcagtgatggaataacttcagttaagaattcctggtttaag
attttacaggaatacgttgaacatcaggttgatgatgcaatgatggcaaatgcagcccag
aaatttcccttcaatactcctaaaaccaaagaaggatattactaccgtcaaatctttgaa
cgccattacccaggccgggctgactggctgagccattactggatgcccaagtggatcaat
gccactgacccttctgcccgcacactgacccactacaagtcagctgccaaagcttag

DBGET integrated database retrieval system