KEGG   Macaca mulatta (rhesus monkey): 697233Help
Entry
697233            CDS       T01028                                 

Definition
histone-lysine N-methyltransferase MLL5-like
Orthology
K09189  
histone-lysine N-methyltransferase MLL5 [EC:2.1.1.43]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    697233
Enzymes [BR:mcc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     697233
Transcription factors [BR:mcc03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    697233
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 1859 aa AA seqDB search
MSIVIPLGVDTAETSYLEMAAGSEPESVEASPVVVEKSNSYPHQLYTSSSHHSHSYIGLP
YADHNYGARPPPTPPASPPPSVLISKNEVGIFTTPNFDETSSATTISTSEDGSYGTDVTR
CICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDTYLCERCQPRNLDKERAVLLQRRK
RENMSDGDTSATESGDEVPVELYTAFQHTPTSITLTASRVSKVNDKRRKKSGEKEQHISK
CKKAFREGSRKSSRVKGSAPEIDPSSDGSNFGWETKIKAWMDRYEEANNNQYSEGVQREA
QRIALRLGNGNDKKEMNKSDLNTNSLLFKPPVESHIQKNKKILKSAKDLPPDALIIEYRG
KFMLREQFEANGYFFKRPYPFVLFYSKFHGLEICVDARTFGNEARFLRRSCTPNAEVRHE
IQDGTIHLYIYSIQSIPKGTEITIAFDFDYGNCKYKVDCACLKENPECPVLKRSSESMEN
ISSGYETRRKKGKKDKDISKEKDTQNQNITLDCEGTTNKMKSPETKQRKLSPLRLSVSNN
QEPDFIDDIEEKTPVSNEVEMESEEQIAERKRKMTREERKMEAILQAFARLEKREKRREQ
ALERISTAKTEVKTECKDTQIVSDAEVIQEQAKEENASKPTPAKVNRTKQRKSFSRSRTH
IGQQRRRHRTVSMCSDIQPSSPDIEVTSQQNDIENTVLTIEPETETALAEIITETEVPAL
NKCPTKYPKTKKHLVNEWLSEKNEKTGKPSDGLSERPLRITTDPEVLATQLNSLPGLTYS
PHVYSTPKHYIRFTSPFLSEKRRRKEPTENISGSCKKRWLKQALEEENSAILHRFNSPCQ
ERSRSPAVNGENKSPLLLNDSCSLSDLTTPLKKRRFYQLLDSVYSETSTPTPSPYATPTH
TDITPMDPSFATPPRIKSDDETCRNGYKPIYSPVTPVTPGTPGNTMHFENISSPESSPEI
KRRTYSQEGYDRSSTMLTLGPFRNSNLTELGLQEIKTIGYMSPRSRTEVNRQCPGEKEPM
SDLQLGLDAVEPTALHKTLEAPAHDRAEPNSQLDSTHSGRGTIYSSWVKSPDRTGVNFSV
NSNLRDLTPSHQLEVGGGFRISESKCLMQDDTRGMFMETTVFCTSEDGLVSGFGRTVNDN
LIDGSCTPQNPPQKKKVSLLEYRKRQREARKSGSKTENFPLISVSPHASGSLSNNGDGCA
SSNENGEQVEHTASLPLPTPATVYNATSEETSNNCPVKDATASEKNEPEVQWTASTSVEQ
VRERSYQRALLLSDHRKDKDSGGESPCVSCSPSHVQSSPSSHSNHIPQLQAKGPVPSFSE
LMEDPDPENPEPTTTSECPSPDTSQNTCKSPSKMTKPGSPGSVIPAQAHGKIFTKPDPQW
DSTVTASEAENGVHLKTELQQKQLSNNSQALSKNHPPQTHVRNSSEQLSQKLPSAPTKLH
CPPSPHLENPPKSSTPHTPVQHGYLSPKPPSQQLGSPYRPHHSQSPQVGTPQREPQRNFY
PAAQNLQANTQQATSGTLFTQTPSGQSAATYSQFNQQSLNSTAPPPPPPPPPSSSSYYQN
QQPSANFQNYNQLKGSLSQQTVFTSGPNQALPGTTSQQTVPGHHVTPGHFLPSQNPTIHH
QTAAAVVPPPPPPPPAPGPHLVQQPNSHQQHSVAHVVGPVHAVTPGSHIHSQTAGHHLPP
PPPPPGPAPHHHPPPHPSTGLQGLQAQHQHVVNSAPPPPPPPPPSSVLASGHHTTSAQAL
HHPPHQGPPLFPSSAHPAVPPYPSQATHHTTLGPGPQHQPSGTGPHCPLPVTGPHLQPQG
PNSIPTPTASGFCPHPGSVALPHGVQGPQQASPVPGQIPIHRAQVPPTFQNNYHGSGWH
NT seq 5580 nt NT seq  +upstreamnt  +downstreamnt
atgagcatagtgatcccattgggggttgatacagcagagacgtcatacttggaaatggct
gcaggttcagaaccagaatccgtagaagctagccctgtggtagttgagaaatccaacagt
tatccccaccagttatataccagcagctcacatcattcacacagttacattggtttgccc
tatgcggaccataattatggtgctcgtcctcctccaacacctccggcttcccctcctcca
tcagtccttattagcaaaaacgaagtaggcatatttaccactcctaattttgatgaaact
tccagtgctactacaatcagcacatctgaggatggaagttatggtactgatgtaaccagg
tgcatatgtggttttacacatgatgatggatacatgatctgttgtgacaaatgcagcgtt
tggcaacatattgactgcatggggattgataggcagcatattcctgatacatatctatgt
gaacgttgtcagcctaggaatttggataaagagagggcagtgctactacaacgccggaaa
agggaaaatatgtcagatggtgataccagtgcaactgagagtggtgatgaggttcctgtg
gaattatatactgcatttcagcatactccaacatcaattactttaactgcttcaagagtt
tccaaagttaatgataaaagaaggaaaaaaagtggggagaaagaacaacacatttcaaaa
tgtaaaaaggcatttcgtgaaggatctaggaagtcatcaagagttaagggttcagctcca
gagattgatccttcatctgatggttcaaattttggatgggagacaaagatcaaagcatgg
atggatcgatatgaagaagcaaataacaaccagtatagtgagggtgttcagagggaggca
caaagaatagctctgagattaggcaatggaaatgacaaaaaagagatgaataaatcagat
ttgaatactaacagtttgctcttcaaacctcctgtagagagccatatacaaaagaataag
aaaattcttaaatctgcaaaagatttgcctccggatgcacttatcattgaatacagaggg
aagtttatgttgagagaacagtttgaagcaaatgggtatttctttaaaagaccataccct
tttgtgttattctactctaaatttcatggactagaaatatgtgttgatgcaaggactttt
gggaatgaggctcgattcttaaggcggtcttgtacacccaatgcagaggtgaggcatgaa
attcaagatggaaccatacatctttatatttattctatacaaagtattccaaagggaact
gaaattactattgcctttgattttgactatgggaattgtaagtacaaggtggactgtgca
tgcctcaaagaaaacccagagtgccctgttctaaaacgtagttctgaatccatggaaaat
atcagtagtggttatgagaccagacggaaaaaaggaaaaaaagacaaagatatttcaaaa
gaaaaagatacacaaaatcagaatattactttggattgtgaaggaacaaccaacaaaatg
aagagcccagaaactaaacaaagaaagctttctccattgagactatcagtatcaaataat
caggaaccagattttattgatgatatagaagaaaaaactcctgttagtaatgaagtagaa
atggaatcagaggagcagattgcagaaaggaaaaggaagatgacaagagaagaaagaaaa
atggaagcaattttgcaagcttttgccagacttgaaaagagagagaaaagaagagaacaa
gctttggaaaggatcagcacagccaaaactgaagttaaaactgaatgtaaagatacacag
attgtcagtgatgctgaagttattcaggaacaagcaaaagaagaaaatgctagcaagcca
acccctgccaaagtaaatagaactaaacagagaaaaagtttttctcggagtaggactcac
attggacagcagcgtcggagacacagaactgtcagcatgtgttcggatatccagccatct
tctcctgatatagaagttacttcacaacaaaatgatattgaaaatactgtacttacaata
gaaccagaaactgaaactgcactagcagaaataattactgaaactgaagttccagcactt
aataaatgtcctacaaagtaccccaaaacaaagaagcacttggtcaatgaatggttaagt
gagaagaatgagaagacaggaaaaccttcagatggcctttcagaaaggcctctacgcata
actacagatcctgaagtgttagctacacaactcaattctttaccaggtctcacttacagc
ccccatgtatactctactcctaagcattatattagatttacttcaccattcctttcagaa
aaaaggagaagaaaagaacctactgaaaacatttctggttcatgcaagaagcgatggttg
aaacaagctctggaagaagaaaattcagcaattttacatagatttaattcaccctgtcaa
gaaagatccagaagtcctgcagtcaatggtgaaaacaaaagtccactactattaaatgac
agctgttccctttcagatttaactacaccactaaaaaaacgaagattttatcagttgcta
gattcggtttactcagaaacctccacacctactccttccccgtatgctacaccaactcac
accgatattactcctatggacccatcttttgccacgcctccacggataaaatcagatgat
gaaacttgtagaaatggttataaacccatatattcaccagttaccccagtaactcctggt
acaccaggaaataccatgcactttgagaatatttcttccccagaaagttctccagaaata
aagagacgcacttatagtcaagagggatatgacagatcttcaaccatgttaacattgggg
ccttttagaaattctaatttaactgaactgggtctgcaagaaataaagactattggttat
atgagccctaggagtaggactgaagtcaacaggcagtgccctggagaaaaggaaccgatg
tcagaccttcagctgggactcgatgcggttgagccaactgccctacataaaaccctggaa
gcgcctgcacatgacagggctgagcccaacagccaactggactcgactcactctggacgg
ggcacaatatattcttcctgggtaaagagccctgacagaacaggagttaacttctcagtg
aactccaacttgagggacctgacaccctcgcatcagttggaggttggaggaggcttccga
ataagtgagtcaaagtgcctgatgcaggatgatactagaggcatgtttatggaaacaact
gtgttttgtacttccgaagatgggcttgtatctggtttcggacggactgttaatgacaat
ttgatcgacgggagttgcacaccccagaatccaccacaaaagaaaaaggtttctctatta
gaataccgtaagagacaacgtgaagctaggaaaagtggctctaagacagagaactttcca
ctcattagtgtatcaccccatgcaagtggaagcttgagcaacaatggtgatggctgtgcc
agcagtaatgagaatggggagcaggtggaacacactgctagcctacctttaccaacacca
gctacggtttataatgccacttctgaagaaactagcaataactgccctgttaaggatgct
actgccagtgagaagaatgaaccagaagttcaatggactgcctcaacttcagtggaacaa
gtcagagaaaggagttatcagagagctttacttctcagcgatcaccgaaaagataaagat
agtgggggagaatcaccatgtgtctcatgttcaccgagtcatgttcagtcttcaccttca
tctcattcaaatcacattccccagttgcaagctaagggcccagtcccttctttcagtgaa
cttatggaagaccctgatcctgaaaatccagaacccacaactacaagtgaatgtccatcc
ccagatacttctcaaaatacttgtaaaagtccttcaaaaatgaccaagcctggttcacct
ggatctgtaattcctgctcaagcacatgggaaaatattcacaaaaccagatccccaatgg
gactccacagttactgcatccgaagctgaaaacggtgttcacctaaaaacagagctccaa
caaaaacagctgtcaaataacagccaagcactttcaaagaatcatcctcctcagacacac
gtccgtaattcatctgagcaactttcacaaaagctgccttctgcaccaacaaagttgcac
tgtcctccatcacctcacctagaaaatcctccaaagtcatccacgcctcacacacctgta
cagcatggttatctttcaccaaagcctccttcacagcagttaggatctccctacaggcct
catcattcacagtcacctcaagttggaacacctcagcgagagcctcagagaaacttttat
ccagcagcacagaaccttcaagccaatactcagcaggcaacttctggaacattatttaca
cagacaccctcaggacaatctgcagcaacatacagtcagtttaaccaacaaagtctgaac
agcacggcaccaccccctccacctcctccacctccttcttcttcatcttactatcaaaac
cagcagccctctgcaaactttcagaattataatcagctcaaaggtagtctttctcaacaa
actgtgtttacatcaggaccaaatcaagcacttcctggcaccacaagccagcaaacagtt
ccaggacatcatgtgactccagggcattttttgccctctcagaaccctaccattcaccat
caaactgctgctgctgtagtcccccctcctcctccaccaccgcctgctccaggaccgcac
cttgtacaacagccgaattcccatcagcaacactctgtagcacatgtagtagggcctgtt
catgcggtcacccctgggtcgcatattcattctcaaactgctggacaccacttaccccca
cccccaccccctcccggtcctgcccctcatcaccatccgccaccccatccttccacagga
ctccaaggtctacaagcacaacaccagcatgttgtaaattcagcacccccaccaccccct
ccgccgccaccttccagtgttttggcttctgggcatcataccacatcagctcaagcctta
caccacccacctcatcaaggacctccactttttccttcgagtgctcatccagctgtacca
ccgtatccctcacaagctacacatcataccactttgggaccgggaccccagcaccagcct
tctggaacagggccacattgtccattacctgtcacaggtcctcatctccagccccaagga
ccaaacagtattccaacacctactgcttcagggttctgtcctcatcctggctctgtggcc
ctgccacatggggttcaaggacctcagcaggcatctccagtgcctggacagattccaatt
cacagagcacaggtgccaccaacatttcaaaacaattaccatgggtcagggtggcattaa

DBGET integrated database retrieval system