KEGG   Macaca mulatta (rhesus monkey): 697276Help
Entry
697276            CDS       T01028                                 

Gene name
UCHL3
Definition
ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (EC:3.4.19.12)
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     697276 (UCHL3)
Peptidases [BR:mcc01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   697276 (UCHL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
17
AA seq 230 aa AA seqDB search
MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITE
KYEVFRTEEEEKIKSQGQAVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLK
KFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPNIDEKVDLHFIALVHVDGHL
YELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggagggtcaacgctggctgccgctggaggccaatcccgaggtcaccaaccagtttctc
aaacaattaggtctgcatcctaactggcaattcgtcgatgtatatggaatggatcctgaa
ctccttagcatggtaccaagaccagtctgcgcagtattacttctctttcctattacagaa
aagtatgaagtattcagaacagaagaggaagaaaaaataaaatctcagggacaagctgtt
acatcatcagtatatttcatgaagcaaacgatcagcaatgcctgtggaacaattggactg
attcatgctattgcaaacaataaagacaagatgcactttgaatctggatcaaccttgaaa
aaattcctggaggaatctgtatcaatgagccctgaagaacgagccagatacctggagaac
tatgatgccatccgagttactcatgagaccagtgcccatgaaggtcagactgaggcacca
aatatagatgaaaaagtagatcttcattttattgcattagttcatgtagatgggcatctc
tatgaattagatgggcggaaaccatttccaattaaccatggtgaaactagtgatgaaact
ttattagaggatgccatagaagtttgcaagaagtttatggagcgtgaccctgatgaacta
agatttaatgcgattgctctttctgcagcatag

DBGET integrated database retrieval system