KEGG   Macaca mulatta (rhesus monkey): 697276Help
Entry
697276            CDS       T01028                                 

Gene name
UCHL3
Definition
ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (EC:3.4.19.12)
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
mcc  Macaca mulatta (rhesus monkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17
AA seq 230 aa AA seqDB search
MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITE
KYEVFRTEEEEKIKSQGQAVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLK
KFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPNIDEKVDLHFIALVHVDGHL
YELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggagggtcaacgctggctgccgctggaggccaatcccgaggtcaccaaccagtttctc
aaacaattaggtctgcatcctaactggcaattcgtcgatgtatatggaatggatcctgaa
ctccttagcatggtaccaagaccagtctgcgcagtattacttctctttcctattacagaa
aagtatgaagtattcagaacagaagaggaagaaaaaataaaatctcagggacaagctgtt
acatcatcagtatatttcatgaagcaaacgatcagcaatgcctgtggaacaattggactg
attcatgctattgcaaacaataaagacaagatgcactttgaatctggatcaaccttgaaa
aaattcctggaggaatctgtatcaatgagccctgaagaacgagccagatacctggagaac
tatgatgccatccgagttactcatgagaccagtgcccatgaaggtcagactgaggcacca
aatatagatgaaaaagtagatcttcattttattgcattagttcatgtagatgggcatctc
tatgaattagatgggcggaaaccatttccaattaaccatggtgaaactagtgatgaaact
ttattagaggatgccatagaagtttgcaagaagtttatggagcgtgaccctgatgaacta
agatttaatgcgattgctctttctgcagcatag

DBGET integrated database retrieval system